KEGG   Streptococcus mutans NN2025: SmuNN2025_1137Help
Entry
SmuNN2025_1137    CDS       T01185                                 

Gene name
agaL
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
smc  Streptococcus mutans NN2025
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SmuNN2025_1137 (agaL)
  Lipid metabolism
   00561 Glycerolipid metabolism
    SmuNN2025_1137 (agaL)
   00600 Sphingolipid metabolism
    SmuNN2025_1137 (agaL)
Enzymes [BR:smc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SmuNN2025_1137 (agaL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1194693..1196870)
Genome map
AA seq 725 aa AA seqDB search
MKGEQMGIVIKDNLFYIHTKDSSLIIEERDGDLLLKHLGKKIEAYHFSNTVFEKDHAFSA
NPVADNRNYSYDTQRQIFGVHGFGDFRVPSLILQHDNNDLTRFKFKKAKIIKGGIKARGL
PNPHSSESAQSLALILEDDLAKLRMTLYYTAYDDNATISTFVKFENLSDKPVILHRALST
MFDLPASHYDVITFQGAYAREKTLRRHQIEQGLFKIGSNRGASGHAQTPSLILTEHDSNE
FYGEALALQLIYSGNFQAFVQKNQLNEVRLGIGINDDNFSWDLQANQSFETPVALITYTD
KGLTDLTQESHNFIKRHIIPKNFANKERPILINNWEATYFDFNRSQLLGLADEARKLGIE
LFVLDDGWFGHRFDDNSSLGDWFVNEEKLSGSLDSFIKEIHDRGLQFGLWFEPEMVSVDS
KLYRAHPDWVIQADQREHTYSRNQLVLNLANPDVVAYIKTVLDKLLTENTIDYVKWDYNR
NITNIGNGRTYLETQMQSHAYILGLYNIVSYLTTKHDKVLFESCSGGGGRNDLGMMCYFP
QVWSSDNTDAIARLPIQYGSSYLYPTISMGAHVSAVPNHQMNRHTPLTTRGHVAMMGNLG
YELDLAILTKNEKKAVANQIKHYKKIRSVVQFGKLYRLINPEVGINEVAVQYTYDNQVLV
TYVRIQSTIEMMETTVKLRGLDADAIYVLIETGQVFSGAELMYAGLTIDMPQGDYLSKQY
YFIKK
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaagggagaacaaatgggcattgttattaaagataaccttttttatatacacaccaaa
gactcatcattgattattgaagaaagagatggtgatttgcttttaaaacatctaggtaaa
aaaattgaagcctatcatttttccaatactgtttttgaaaaggatcatgctttttcagct
aatccagtggcggacaatagaaattatagttatgatacacaaagacaaatatttggtgtt
catggttttggtgattttagagtgccttcactaatccttcaacatgataataatgattta
acacggtttaaatttaagaaggctaaaattattaagggggggatcaaggcaagaggtttg
cctaatccacatagcagtgagagtgctcaaagcttggctcttatcttagaagatgatttg
gcaaaactgcgcatgactctgtattatacagcttatgatgataatgccaccatttcaacc
tttgtcaaatttgaaaatttatctgataagcctgttattcttcatcgtgctttatcaaca
atgtttgatttacctgccagccattatgatgtgataacttttcaaggagcttatgctcgc
gagaagacgcttcggcgccaccagattgaacagggtctgtttaaaataggctctaatcga
ggagcttcaggacatgctcaaaccccttccttaattttaacagagcatgatagcaatgag
ttttatggagaggctttggctttacaattaatctatagcggaaattttcaagcttttgtt
caaaaaaatcaattaaacgaggttcgcttaggcatcggaataaatgatgataatttttca
tgggacctgcaggctaatcagagttttgagacacctgtagctttgataacctacactgat
aagggattaacggatctgacacaagaaagtcataattttattaaacgtcatattattcct
aagaattttgctaataaggaacgtcctatccttatcaataattgggaggcaacatatttt
gattttaatcggagtcaattgctggggctggcagatgaagccagaaaacttggcattgaa
ctctttgtgcttgacgatggttggtttggtcatcgttttgatgacaatagctcacttggt
gattggtttgtcaatgaagaaaaacttagtggttcccttgatagctttatcaaggaaatt
catgatagaggattacagttcggcctttggtttgaacccgaaatggtatcagttgacagc
aaactttatagagctcatcctgattgggtcattcaggcagatcagcgagagcatacttat
tctcgcaatcaattggtcttgaatctagctaatcccgatgtagttgcttatatcaaaact
gttcttgataagctgctgacagaaaatacgattgattatgttaaatgggactacaatcgc
aatataaccaatattggcaatggcagaacttacttggaaacgcaaatgcagtcgcatgct
tatatactggggttgtataatattgtttcttacttaacaacaaaacacgataaggtcttg
tttgaatcctgttcaggaggtggcggtcgcaacgatttggggatgatgtgttattttcct
caagtgtggtcaagtgataatacagatgctattgcaagactgcctatacagtatggttcc
tcttatctttacccaactatttctatgggagctcatgtttcagcggttcctaaccatcaa
atgaaccgtcatacccctcttacaacacgaggtcatgttgctatgatgggaaatttaggt
tatgaattggacttagcaatcttaaccaaaaatgaaaaaaaggctgttgccaatcagatt
aaacattataaaaagataaggtctgttgtacaatttggcaagctttaccgtctaattaat
cccgaagttggaattaatgaggtagcagtgcaatatacctatgacaatcaggtactggtt
acctatgtccgtattcaatcaaccatagagatgatggaaacaactgtaaagttgagggga
ctagatgcagatgccatttatgttcttatagaaactggacaagtcttttcaggtgcggag
ttaatgtatgcgggattgaccattgatatgccgcaaggtgattatttgagtaaacaatac
tattttattaaaaagtag

DBGET integrated database retrieval system