KEGG   Streptococcus mutans NN2025: SmuNN2025_1145Help
Entry
SmuNN2025_1145    CDS       T01185                                 

Gene name
pfkB
Definition
fructose-1-phosphate kinase
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
smc  Streptococcus mutans NN2025
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:smc00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1207020..1207931)
Genome map
AA seq 303 aa AA seqDB search
MIYTVTLNPSIDFIVRIDSVKIGSVNRMDSDDKFVGGKGINVSRILKRLGQDNTATGFIG
GFTGRFVEEGLIAEGIKTNFVHVNQDTRINVKIKADQETEINGTGPVITKEQVLALENIL
QQLSQDDTVVFAGSAPSNLGNQIYERLIPLVRQTGAQIVCDFEGQTLLDALDYQPLLVKP
NNHELEAIFKVNLNGITDVEKYARQILAKGAQNVIISMAGDGALLVTSDATYFAKPIKGQ
VRNSVGAGDSMVAGFTGEFVKSANPLEALKWGVACGTATAFSDDLASIDFIKETYEKVEV
EKL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacggtaacccttaatccttctattgattttatcgttcgtattgatagtgta
aaaatcggcagtgtcaatcgtatggatagtgacgataaatttgttggaggtaaagggatt
aatgttagtcgtattcttaagcgtttaggacaggataatacggcgacaggttttattggc
ggttttactggtaggtttgttgaggaaggattgattgctgaaggaatcaagactaacttt
gtccatgttaatcaagataccagaattaatgtcaaaattaaggctgatcaagaaactgaa
attaatggtacaggccctgtcattacaaaagaacaagttttagctttagagaacatctta
cagcaactttcacaagacgatacagttgtttttgcaggcagtgcaccgtccaatttagga
aaccaaatttatgaacgcttgatcccgttggtgagacaaacaggagcgcaaattgtttgc
gattttgaagggcaaactttattggatgctcttgactatcaaccgcttttggttaaacca
aataatcatgaacttgaagctattttcaaggtaaatttaaacggtattactgatgttgaa
aagtatgcccgccaaattcttgctaaaggcgcacaaaacgtcattatttcaatggcagga
gatggcgctttattagtaacatcagatgcgacttattttgctaaaccgattaagggacag
gtcagaaattctgtcggtgctggtgattcaatggttgctggttttactggtgaatttgtt
aagtcagctaatcctcttgaagctctcaaatggggagtggcttgcggtacagcaaccgct
ttttcagatgatttagccagtattgattttataaaagaaacatatgaaaaagtagaggta
gaaaaattatga

DBGET integrated database retrieval system