KEGG   Streptococcus mutans NN2025: SmuNN2025_1382Help
Entry
SmuNN2025_1382    CDS       T01185                                 

Gene name
pmgY
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
smc  Streptococcus mutans NN2025
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:smc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:smc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smc00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:smc00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:smc00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1465396..1466088)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEEGTQQAIDAGKLIKEADIKFDLAFTSVLTR
AIKTTNLALEYSDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEKFGDEQVHIWRRSYDVL
PPAMAKDDPYSAHTDRRYANLDDTVIPDAENLKVTLERALPYWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDDIMGVEIPNFPPLVFEFDENLNVTAEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattagtatttgctcgtcatggtgaatcagaatggaacaaggctaaccttttt
actggctgggctgatgttgacctttcagaagaaggaacgcaacaagcaattgatgccggc
aaactcattaaagaagcagacatcaaatttgaccttgctttcacatcagttttgacacgt
gcaatcaagacaactaatttggcgcttgaatattctgatcaactttgggtaccagttgaa
aagtcatggcgtttgaatgaacgtcactatggtggcttgactggtaaaaataaagctgaa
gctgctgaaaaatttggagacgaacaagttcacatttggcgtcgctcatatgatgtattg
ccgccagctatggccaaagacgatccatactcagcacacactgaccgtcgttatgcaaat
cttgatgatactgttattccagatgcagaaaacttaaaagtcaccttagaacgtgctctt
ccatactgggaagataaaattgctccagctcttaaagatggaaaaaatgtatttgttgga
gcacatggtaactctatccgtgctcttgtaaaacatatcaaacaattgtcagatgatgac
attatgggtgttgaaattccaaacttcccaccattagtttttgaatttgacgaaaattta
aatgtcactgctgaatactatcttggtaaataa

DBGET integrated database retrieval system