KEGG   Streptococcus mutans NN2025: SmuNN2025_1434Help
Entry
SmuNN2025_1434    CDS       T01185                                 

Gene name
trpB
Definition
(GenBank) putative tryptophan synthase beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
smc  Streptococcus mutans NN2025
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SmuNN2025_1434 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SmuNN2025_1434 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SmuNN2025_1434 (trpB)
Enzymes [BR:smc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SmuNN2025_1434 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1514654..1515865)
Genome map
AA seq 403 aa AA seqDB search
MTYNQPNNNGFYGNFGGQFIPETLMTAVIELDEAYREAKADPSFHEELDALLKDYVGRET
PLYFAKRLTDYIGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKNKIIAETGAGQHG
VATATAAALFDMECTIYMGEEDVKRQALNVFRMELLGAKVHSVTDGSRVLKDAVNAALRA
WVTNIEDTHYVMGSALGPAPFPEIVRDFQSVIGREAKRQFATVSNGQLPDAVLACIGGGS
NAIGLFYPFVNDESVAMYGAEASGLGLDTDKHAATFAKGRPGVLHGALMDVLQDEHGQIM
EAFSISAGLDYPGVGPEHCYFNEIGRATYDSITDEEALESFKLLSRLEGIIPALESSHAI
ALTQKVAKELGADKSIIVCLSGRGDKDVAQVKERLKQEAKEGK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgacatataatcaacccaataacaacggtttttatggtaattttggaggacaattcatt
cctgaaacgctgatgacagctgttattgaattggatgaggcttatcgtgaagccaaagct
gatcctagttttcatgaagaattagatgctctcttaaaagattatgttggtcgtgaaact
cccttgtactttgctaaacgtttgacggattatattggtggtgccaaaatttatctaaaa
cgtgaagatcttaatcatacaggtgctcacaaaatcaataatgcactggggcaagttctt
ttagctaagcgtatggggaaaaataagattattgctgaaacaggtgcaggacagcatggt
gttgcaacagcaacagcagcggctctctttgatatggaatgtaccatttatatgggggaa
gaagatgtgaaacgtcaagctcttaatgtctttcggatggagctattaggtgctaaagtg
cattctgttacggatggatcgcgtgtgcttaaagatgcagtcaatgcagctttgcgagca
tgggtaaccaatattgaggatacccattatgttatgggatctgctcttggaccagctcct
ttcccagaaattgttcgtgatttccaatcggttattggcagagaagctaaacgtcaattt
gcgacagtttcaaatggacagctgccagatgcagtcttagcttgtatcggtggcggctcc
aatgcaatcggactcttttatccttttgtcaacgatgaatcagttgccatgtatggtgcg
gaagcgtcaggtttagggcttgataccgataagcatgcggcaacctttgccaaaggacga
ccaggtgttttacatggtgctcttatggatgtgctgcaggatgagcatggacagattatg
gaagctttctcgatttccgcgggccttgactatccaggtgttggtcctgaacactgctat
ttcaatgaaattggacgtgcaacttacgattctattacggatgaagaagctctggaatct
ttcaaattgctatctcgtctggaaggcattattcctgcattagaatctagtcatgcgatt
gctctgacacaaaaagttgcgaaggaactaggagcggataagtccattattgtttgcctc
tcaggacgtggtgataaggatgtggctcaggttaaagaacgtcttaagcaggaagcaaaa
gaagggaagtag

DBGET integrated database retrieval system