KEGG   Streptococcus mutans NN2025: SmuNN2025_1576Help
Entry
SmuNN2025_1576    CDS       T01185                                 

Definition
hypothetical protein
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
smc  Streptococcus mutans NN2025
Brite
Enzymes [BR:smc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     SmuNN2025_1576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1660201..1661247
Genome map
AA seq 348 aa AA seqDB search
MNSPYTRSPRTIKHAFVTGATGLLGNNLVRALLKQGIKVTALVRSMEKARLQFGNLPIQY
VKGDILNPEAFRSAFTDCDTLFHTAAFFRDSHKGGKHWQELYDTNVTGTTHLLKAAYEEG
IRQMIHTSSIAVLKGERHQLIDETMSRDPSTKLDYYRSKILSENAVSNFLKEYPDLFLCY
VLPGSMYGPGDMGPTATGQLILDYMQQKLPGIITKASYSVVDTRDVADIHILALKYGRRN
ERYLAAGRHMTMESIVKTLEEITGIPAPKRHIPIFLVQALAQWNELYHKITGKPVLVSKE
IADITAEEYLRTYFSHKKTEQELGGQFRPFEETLLDTVRWYRNHGYLN
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaattctccttacacaagaagtccaagaactatcaaacatgcttttgtaactggtgcc
accggtcttttaggtaacaatcttgttcgcgctttacttaaacaaggtattaaagtcact
gctctcgtacgttccatggaaaaagctaggttacaatttggtaatttgcctatccagtat
gttaaaggagacatccttaatcccgaagcttttcggtctgcttttaccgattgcgacact
ctttttcatacagctgctttttttcgcgatagtcacaaaggcggaaaacattggcaagaa
ctctacgatactaatgttacaggaaccactcatttattgaaagcagcctacgaagaaggt
attcgtcaaatgattcatacgtcttctattgctgtacttaaaggggaacgtcatcagcta
attgatgagacgatgtcacgagatcctagtaccaaattagactattatcgtagtaaaatc
ctaagcgaaaatgctgtgagcaattttcttaaggagtatccagatttatttctttgctat
gttttaccaggttctatgtatggtccgggagatatgggaccaactgctacgggacaacta
atcttggattacatgcagcaaaaactacccgggatcatcaccaaagctagctatagtgtc
gttgataccagagatgttgctgatattcatattttagctctaaaatacgggcgcagaaat
gaacgctatttggcagcaggccgtcatatgactatggaaagtattgtcaaaaccttggaa
gaaataacaggcattcctgctccaaaacgtcatattcccatttttctagttcaggcatta
gcccaatggaatgaactttatcataagattactggcaaacctgttctggtcagtaaagaa
attgcagacattacagctgaagaatatcttcggacatattttagccataaaaaaactgag
caggaacttggcgggcaattccgaccttttgaagaaaccttattagatactgtccgttgg
taccgcaatcacggctatctgaactag

DBGET integrated database retrieval system