KEGG   Streptococcus mutans NN2025: SmuNN2025_1627Help
Entry
SmuNN2025_1627    CDS       T01185                                 

Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smc  Streptococcus mutans NN2025
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SmuNN2025_1627
   00052 Galactose metabolism
    SmuNN2025_1627
   00500 Starch and sucrose metabolism
    SmuNN2025_1627
   00520 Amino sugar and nucleotide sugar metabolism
    SmuNN2025_1627
Enzymes [BR:smc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SmuNN2025_1627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1712742..1713698
Genome map
AA seq 318 aa AA seqDB search
MSLERKMNGVNNMPSKKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEAL
KSGIEDILVVTGKSKRSIEDHFDSNFELEYNLEQKGKTDLLKLVNDTTAINLHFIRQSHP
RGLGDAVLQAKAFVGNEPFVVMLGDDLMDITDDKAIPLTRQLMNDYEETHASTIAVMEVP
HEDVSAYGVIAPQGEGVSGLYSVDTFVEKPAPKEAPSNLAIIGRYLLTPEIFTILETQEP
GAGNEVQLTDAIDTLNKTQRVFAREFKGKRYDVGDKFGFMKTSIDYALKHPQVKEDLKAY
IIELGKKLDQKSTQKNSD
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagagcggaaaatgaatggagtaaataatatgccaagtaaaaaagtcagaaaa
gctgtcatccctgcggcaggtttaggaacacgtttccttcctgctaccaaggctcttgcc
aaagaaatgctaccaattgttgataaaccaaccattcagtttatcgttgaagaagcttta
aaatcaggtattgaagacatcctagtggttacaggtaaatcaaaacgttctattgaagat
cattttgattcaaattttgaacttgagtacaatcttgaacaaaaaggaaaaacagattta
cttaaactcgttaatgatactactgcaatcaatctccattttatccgtcaaagccatccg
cgcgggttaggtgatgctgttcttcaggctaaagcctttgtaggtaatgaacctttcgtt
gttatgctcggtgatgatttgatggatattacagatgacaaggctatccctttgacacgt
caactcatgaacgattatgaagaaacgcatgcctcaacgattgcagtcatggaggttccc
catgaagatgtttctgcctatggtgtaattgctcctcaaggagaaggagttagtggcctt
tacagtgtcgatacttttgttgaaaaacctgctcctaaagaagcgcctagcaatctagct
atcattggtcgttacttattaacgccggaaatttttacaattcttgaaacacaagaaccc
ggtgctggcaacgaagttcaattaacagatgccattgatactcttaataaaacacaacgt
gtttttgcacgtgaatttaagggaaaacgttatgatgttggtgataaatttggtttcatg
aagacttcaattgattatgcacttaaacatccacaagttaaagaagatttaaaagcttat
attattgaacttggtaaaaaattagaccaaaaatcgactcaaaagaactcggattaa

DBGET integrated database retrieval system