KEGG   Streptococcus mutans NN2025: SmuNN2025_1627Help
Entry
SmuNN2025_1627    CDS       T01185                                 

Definition
(GenBank) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smc  Streptococcus mutans NN2025
Pathway
smc00040  Pentose and glucuronate interconversions
smc00052  Galactose metabolism
smc00500  Starch and sucrose metabolism
smc00520  Amino sugar and nucleotide sugar metabolism
smc01100  Metabolic pathways
smc01130  Biosynthesis of antibiotics
Module
smc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SmuNN2025_1627
   00052 Galactose metabolism
    SmuNN2025_1627
   00500 Starch and sucrose metabolism
    SmuNN2025_1627
   00520 Amino sugar and nucleotide sugar metabolism
    SmuNN2025_1627
Enzymes [BR:smc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SmuNN2025_1627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD DUF1079
Motif
Other DBs
NCBI-ProteinID: BAH88653
Position
1712742..1713698
Genome map
AA seq 318 aa AA seqDB search
MSLERKMNGVNNMPSKKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEAL
KSGIEDILVVTGKSKRSIEDHFDSNFELEYNLEQKGKTDLLKLVNDTTAINLHFIRQSHP
RGLGDAVLQAKAFVGNEPFVVMLGDDLMDITDDKAIPLTRQLMNDYEETHASTIAVMEVP
HEDVSAYGVIAPQGEGVSGLYSVDTFVEKPAPKEAPSNLAIIGRYLLTPEIFTILETQEP
GAGNEVQLTDAIDTLNKTQRVFAREFKGKRYDVGDKFGFMKTSIDYALKHPQVKEDLKAY
IIELGKKLDQKSTQKNSD
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagagcggaaaatgaatggagtaaataatatgccaagtaaaaaagtcagaaaa
gctgtcatccctgcggcaggtttaggaacacgtttccttcctgctaccaaggctcttgcc
aaagaaatgctaccaattgttgataaaccaaccattcagtttatcgttgaagaagcttta
aaatcaggtattgaagacatcctagtggttacaggtaaatcaaaacgttctattgaagat
cattttgattcaaattttgaacttgagtacaatcttgaacaaaaaggaaaaacagattta
cttaaactcgttaatgatactactgcaatcaatctccattttatccgtcaaagccatccg
cgcgggttaggtgatgctgttcttcaggctaaagcctttgtaggtaatgaacctttcgtt
gttatgctcggtgatgatttgatggatattacagatgacaaggctatccctttgacacgt
caactcatgaacgattatgaagaaacgcatgcctcaacgattgcagtcatggaggttccc
catgaagatgtttctgcctatggtgtaattgctcctcaaggagaaggagttagtggcctt
tacagtgtcgatacttttgttgaaaaacctgctcctaaagaagcgcctagcaatctagct
atcattggtcgttacttattaacgccggaaatttttacaattcttgaaacacaagaaccc
ggtgctggcaacgaagttcaattaacagatgccattgatactcttaataaaacacaacgt
gtttttgcacgtgaatttaagggaaaacgttatgatgttggtgataaatttggtttcatg
aagacttcaattgattatgcacttaaacatccacaagttaaagaagatttaaaagcttat
attattgaacttggtaaaaaattagaccaaaaatcgactcaaaagaactcggattaa

DBGET integrated database retrieval system