KEGG   Streptococcus mutans NN2025: SmuNN2025_1827Help
Entry
SmuNN2025_1827    CDS       T01185                                 

Definition
Holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
smc  Streptococcus mutans NN2025
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:smc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SmuNN2025_1827
Enzymes [BR:smc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SmuNN2025_1827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1935613..1936209)
Genome map
AA seq 198 aa AA seqDB search
MMYDYIKGNLTKITAKYIVLEAGGLGYVINVANPYSFSNQINQAIQIYIHHVVREDAHLL
YGFHTEDEKAVFLNLISVSGIGPTSALAIIAADDNEGLVKAIDHSDVNYLMKFPKIGKKT
AQQMVLDLAGKFVDINEVSTDKSKVSTINNNQELEEAVEALLALGYKTNELKKIEKFFEG
TTDTAENYIKSALKMLMK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatgtacgattatattaaagggaatttaaccaaaattacagctaaatatattgtttta
gaagctggcggtttgggttatgtaattaatgttgccaatccttatagtttttctaatcag
ataaatcaagctattcaaatttatattcaccatgttgtccgtgaagatgcccatcttctt
tatggttttcatactgaggatgaaaaggcggtttttcttaatcttatctctgtttcagga
atcggtccaacttcagcattagctattattgcggctgatgataatgaaggtttggttaaa
gctattgaccacagtgatgtaaactatttgatgaaattccctaaaattgggaagaaaaca
gctcaacaaatggtgcttgatttagcaggtaaatttgtagatattaatgaagtctcaact
gataaaagcaaagtgagcactattaataataatcaagaacttgaagaggcggttgaagca
cttttggctcttggttacaaaacaaatgaacttaagaagatagaaaaattttttgaagga
acgactgatacggcagaaaattatattaaatctgctctaaaaatgttgatgaaatag

DBGET integrated database retrieval system