KEGG   Sinorhizobium medicae: Smed_0052Help
Entry
Smed_0052         CDS       T00555                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
smd  Sinorhizobium medicae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Smed_0052
Enzymes [BR:smd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Smed_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(55019..55939)
Genome map
AA seq 306 aa AA seqDB search
MITVFGSINMDLIATTARLPKPGETVAGTGFSTAAGGKGANQALAARRAGASVQMAGAVG
SDAFAEGALALLREAGTNLDLTKTVAEPTGTAHIIVGGDGENVIVVVASANAIVSEDDAA
SAVEKMSPGDTLMLQLEIPAASVEKALAEAKRRNVRSIINIAPLTPDAARLGRSADFVIA
NETEFELLAGKSGITGTEREEAMKQLHAETGQSVIVTLGAEGVVAFHEGDLHRAKGLTIE
PVDTVGAGDTFCGYLAAGLDAGLDFAEALRRAAVAGSLACLKPGAQPSIPLAAEVAARLQ
SNSAIA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgtttttgggtccatcaatatggacctgatcgccacgaccgctcgccttccg
aagcccggcgagacggtcgccggaacaggcttttccactgcggcaggcggcaagggagca
aaccaggcgctcgccgcgcgccgtgccggcgcctcggtacagatggcaggtgcggtcggg
tccgacgccttcgccgagggagcgctggcgctgctgagagaggcgggcaccaatcttgat
ctgacgaagaccgtcgcggagccgaccggtacggcgcacatcatcgtcggcggcgatggc
gaaaacgtcatcgtcgtggttgccagcgccaatgcgatcgtgagcgaggacgacgctgcg
agcgcggtcgaaaagatgtcgcccggcgacacgctgatgctgcagctggaaatccccgca
gcctcggtggaaaaggcccttgctgaagcaaagcggcggaacgttcgttcgatcatcaat
atagcgccgctgacgcccgatgcggcccgcctcggtcgcagcgccgatttcgtcatcgcc
aacgaaacggagttcgagctgctcgctgggaaatcgggcatcaccggcaccgagcgggaa
gaggcgatgaagcagctgcatgcagagacaggtcagtcagtcatcgttacgctcggcgcc
gagggcgtggtggcgttccacgaaggcgacctccatcgtgccaaaggactgacgatagag
cccgtcgacaccgtgggtgccggcgatacgttctgcggctatctcgccgccggcctcgac
gccggcctcgacttcgccgaggctctgcgccgcgctgcggttgcgggctcgctcgcctgc
ctcaagcccggcgcccagccctcgatcccgcttgccgccgaggtcgctgcccggctccag
agcaattccgcgattgcgtag

DBGET integrated database retrieval system