KEGG   Sinorhizobium medicae: Smed_0208Help
Entry
Smed_0208         CDS       T00555                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
smd  Sinorhizobium medicae
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smd01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:smd00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
235116..236420
Genome map
AA seq 434 aa AA seqDB search
MAIRLNYLDTGFERDFAAFLTTKREVSEDVNAVVRDIIDDVRARGDAALADYSARFDGID
FNVTGMAVTAAEIDAAIHAVAPEVLGALKVAATRIEAHHRRQLPKDDIYEDQMGVGLGSR
WTPIDAVGLYVPGGTASYPSSVLMNALPAKVAGVPRIVMVVPAMGGAVNPAVLAAARLAG
VEEIYRIGGAQAVAALAYGTGTIAPVAKIMGPGNAYVAAAKRQVFGTVGIDMIAGPSEVL
VIADRDNDPDWIAADMLAQAEHDAGAQAILITDDAAFGDAVEEAVERQLKTLPRADTAAA
SWRDFGAIILVPDFDKAIPLANRIAPEHLELATADPDAMVPAIRNAGAIFIGRHTPEVIG
DYVGGSNHVLPTARSARFSSGLGVLDYMKRTSILRLDPEQLRILGPAAIALARSEGLEAH
ARSVAIRLNLGEKG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttggcaatcaggctgaactatctcgataccggctttgagcgcgatttcgccgcattcctg
acgaccaagcgggaagtttccgaagacgtaaacgccgtcgtgcgcgacattatcgacgat
gtccgcgcgcgcggcgatgcggcgcttgcagattattcggcgcgttttgacggaatagac
ttcaatgtcacgggcatggcggtgacggcggcggagatagatgcggcgatccacgccgtt
gctccggaggttctcggcgccctgaaggtcgccgcgacccgcatcgaggcgcatcaccgg
cggcaattgccgaaggacgacatctatgaagaccagatgggcgtcggcctcggctcccgc
tggacgccgatcgatgcggtgggcctctatgttccgggtggcacggcgagctatccgagc
tcggttctgatgaacgctctgccggcaaaggtcgccggcgtcccccgcatcgtcatggtc
gtgccggcaatgggcggtgcggtcaatcctgcggtgcttgcggcggcgcggctcgccggc
gtggaagaaatctatcgcatcggtggtgcccaggccgtcgcggcccttgcctacgggacc
gggacgatcgcgccggtggccaaaatcatgggccccggaaacgcctatgtcgcggccgcc
aagcgacaggttttcggcaccgtcggcatcgacatgatcgccggaccttcggaagtgctg
gtgattgcggatcgcgacaacgatccggattggatcgccgcggacatgcttgctcaggca
gagcacgatgccggcgctcaggcgatcctgatcaccgacgatgccgctttcggcgatgca
gtcgaagaggctgtggagcgtcagttgaagacgctgccgcgtgccgacacggcggcagcg
agctggcgcgatttcggtgccatcattctggttccggatttcgacaaggccatcccgctc
gccaaccgcatcgctcccgaacatctcgaactggcgacggccgatccggacgcgatggtc
cccgccatccgcaatgccggcgcgatcttcatcggcaggcacacgcccgaagtcatcggc
gattatgtgggcggttccaaccacgtgctgccgacggcgcgttcggcgcgcttctcgtcc
ggcctcggcgtgctcgactatatgaagcgaacgtctatcctgcggctcgatccggaacag
ttgcgcatactcggccccgccgcgatcgcgctggcgagatcggaagggctcgaggctcac
gcccgatcggtcgcaatccgcctcaacctcggggaaaagggatga

DBGET integrated database retrieval system