KEGG   Sinorhizobium medicae: Smed_0208Help
Entry
Smed_0208         CDS       T00555                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
smd  Sinorhizobium medicae
Pathway
smd00340  Histidine metabolism
smd01100  Metabolic pathways
smd01110  Biosynthesis of secondary metabolites
smd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Smed_0208 (hisD)
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Smed_0208 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 5321039
NCBI-ProteinID: YP_001325902
JGI: Smed0208
UniProt: A6U5Y7
Position
235116..236420
Genome map
AA seq 434 aa AA seqDB search
MAIRLNYLDTGFERDFAAFLTTKREVSEDVNAVVRDIIDDVRARGDAALADYSARFDGID
FNVTGMAVTAAEIDAAIHAVAPEVLGALKVAATRIEAHHRRQLPKDDIYEDQMGVGLGSR
WTPIDAVGLYVPGGTASYPSSVLMNALPAKVAGVPRIVMVVPAMGGAVNPAVLAAARLAG
VEEIYRIGGAQAVAALAYGTGTIAPVAKIMGPGNAYVAAAKRQVFGTVGIDMIAGPSEVL
VIADRDNDPDWIAADMLAQAEHDAGAQAILITDDAAFGDAVEEAVERQLKTLPRADTAAA
SWRDFGAIILVPDFDKAIPLANRIAPEHLELATADPDAMVPAIRNAGAIFIGRHTPEVIG
DYVGGSNHVLPTARSARFSSGLGVLDYMKRTSILRLDPEQLRILGPAAIALARSEGLEAH
ARSVAIRLNLGEKG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttggcaatcaggctgaactatctcgataccggctttgagcgcgatttcgccgcattcctg
acgaccaagcgggaagtttccgaagacgtaaacgccgtcgtgcgcgacattatcgacgat
gtccgcgcgcgcggcgatgcggcgcttgcagattattcggcgcgttttgacggaatagac
ttcaatgtcacgggcatggcggtgacggcggcggagatagatgcggcgatccacgccgtt
gctccggaggttctcggcgccctgaaggtcgccgcgacccgcatcgaggcgcatcaccgg
cggcaattgccgaaggacgacatctatgaagaccagatgggcgtcggcctcggctcccgc
tggacgccgatcgatgcggtgggcctctatgttccgggtggcacggcgagctatccgagc
tcggttctgatgaacgctctgccggcaaaggtcgccggcgtcccccgcatcgtcatggtc
gtgccggcaatgggcggtgcggtcaatcctgcggtgcttgcggcggcgcggctcgccggc
gtggaagaaatctatcgcatcggtggtgcccaggccgtcgcggcccttgcctacgggacc
gggacgatcgcgccggtggccaaaatcatgggccccggaaacgcctatgtcgcggccgcc
aagcgacaggttttcggcaccgtcggcatcgacatgatcgccggaccttcggaagtgctg
gtgattgcggatcgcgacaacgatccggattggatcgccgcggacatgcttgctcaggca
gagcacgatgccggcgctcaggcgatcctgatcaccgacgatgccgctttcggcgatgca
gtcgaagaggctgtggagcgtcagttgaagacgctgccgcgtgccgacacggcggcagcg
agctggcgcgatttcggtgccatcattctggttccggatttcgacaaggccatcccgctc
gccaaccgcatcgctcccgaacatctcgaactggcgacggccgatccggacgcgatggtc
cccgccatccgcaatgccggcgcgatcttcatcggcaggcacacgcccgaagtcatcggc
gattatgtgggcggttccaaccacgtgctgccgacggcgcgttcggcgcgcttctcgtcc
ggcctcggcgtgctcgactatatgaagcgaacgtctatcctgcggctcgatccggaacag
ttgcgcatactcggccccgccgcgatcgcgctggcgagatcggaagggctcgaggctcac
gcccgatcggtcgcaatccgcctcaacctcggggaaaagggatga

DBGET integrated database retrieval system