KEGG   Sinorhizobium medicae: Smed_0536Help
Entry
Smed_0536         CDS       T00555                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
smd  Sinorhizobium medicae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Smed_0536
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smed_0536
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Smed_0536
Enzymes [BR:smd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Smed_0536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(579053..580450)
Genome map
AA seq 465 aa AA seqDB search
MKYISTRGEAASLGFCDALLAGLARDGGLYLPETWPMLTKKEIRALRGKSYQEIAFTVLE
PFTNGEIPAAKFREMIDEAYATFRHPAVAPLVQTGPNAFVMELFHGSTLAFKDVAMQLLA
RLMDHVLAERGARATIVGATSGDTGGAAIDAFAGRERTDIFILFPEGKVSPVQQRQMTTS
AASNVHAVAVKGNFDDCQNLVKAMFNDQAFRDRVQLSGVNSINWARIMAQIVYYFTTAVS
LGAPDRKISFTVPTGNFGDIFAGYVAKRMGLPIDKLVIATNENDILARTLKTGRYEMRGV
KATTSPSMDIQISSNFERLIFEANERNPAAVRAAMAGLGQSGSFTIGDAALKKIRKEFRA
GRASEKEVTKTIRQTFDETGYLLDPHTAIGVFVAAKHAKTSTPMVTLATAHPAKFPAAVK
SASGIDPTLPTWLADLMTRAERFDILDPELKTVETFIDERTRVRD
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtatatttcgacacggggagaagcggcctctctcggtttctgcgatgctcttctg
gcgggacttgcccgcgacggcggcctctatttgcccgaaacatggccgatgctcacgaag
aaggagatccgagccctacgcggcaaatcctatcaggagatcgcctttaccgttctcgag
cccttcaccaatggcgaaatcccggcagccaagttccgcgaaatgatcgacgaggcctac
gccacctttcgtcatccggccgtcgcgcccctggtccaaaccggcccgaacgccttcgtg
atggaactcttccacggttcgacgctggccttcaaggacgtggccatgcaattgctcgcc
cggctgatggaccatgtgctcgccgaacggggcgcgcgggcgacgatcgtgggagcgacg
tccggcgataccggcggtgccgcaatcgacgctttcgccggtcgcgagcgtaccgacatc
ttcatcctctttccggagggcaaggtatcgccggtgcagcaaagacagatgaccacgtcg
gcggcatcgaacgtgcacgcagtcgccgtcaaaggcaatttcgacgactgccagaacctg
gtcaaagccatgttcaacgatcaggccttccgcgaccgggtgcagctttccggcgtcaat
tcgatcaactgggcgcgcatcatggcccagatcgtctattattttacgacagcagtctct
ctcggcgctccggaccggaagatttccttcacggtgccgaccggaaatttcggagacatt
tttgccggctacgttgccaagcgcatgggtttgcccatcgacaagctggtcatcgccacc
aacgaaaacgacatcctggcgcgcaccctgaagaccggccgctacgagatgcgcggggtc
aaggcgacgacctcgccgtcgatggacatccagatctcatcgaacttcgaaaggctcatc
ttcgaagccaacgaacgaaatccggcggcggtccgggcggccatggcgggccttggacaa
tccggttcgttcacgataggcgatgctgcactgaaaaaaatccgcaaggaatttcgcgcc
gggcgcgcctcagagaaagaggtgacgaaaacaatccgacagactttcgatgagaccggc
tatcttcttgatccgcatacggcaatcggcgttttcgtcgcggccaagcacgcgaagacc
tccactccgatggtcacccttgcgaccgcccatccggcgaaatttcccgccgcagtaaaa
tcggcaagtggtattgaccccacgcttccgacgtggcttgctgatctcatgactagggcg
gagcgtttcgacatcctggatccggagctcaagaccgtcgaaaccttcatcgatgagcgt
acccgcgttcgggattag

DBGET integrated database retrieval system