KEGG   Sinorhizobium medicae: Smed_0556Help
Entry
Smed_0556         CDS       T00555                                 

Definition
(RefSeq) XRE family transcriptional regulator
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_31 HTH_26 HTH_19 YdaS_antitoxin HTH_10
Motif
Other DBs
NCBI-GeneID: 5321392
NCBI-ProteinID: YP_001326247
JGI: Smed0556
UniProt: A6U6Y2
Position
complement(603964..604152)
Genome map
AA seq 62 aa AA seqDB search
MAGENAVKVWRSHRGMAARELAKKAGISAPYLSESKSGKKDGSPFAVRKIADAPSVDLDD
LG
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atggctggcgagaacgcggtcaaggtctggcgctcccatcgcggcatggccgctcgggaa
ctggcaaaaaaggccgggatcagcgctccgtatctctccgaaagcaagagcgggaagaag
gatggaagtcctttcgccgtgaggaagattgcagatgctccttccgttgatctcgacgat
ttggggtaa

DBGET integrated database retrieval system