KEGG   Sinorhizobium medicae: Smed_0570Help
Entry
Smed_0570         CDS       T00555                                 

Definition
(RefSeq) L-asparaginase II
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asparaginase_II
Motif
Other DBs
NCBI-GeneID: 5321406
NCBI-ProteinID: YP_001326261
JGI: Smed0570
UniProt: A6U6Z6
Position
619108..620118
Genome map
AA seq 336 aa AA seqDB search
MSNPVLVEVTRGNLVESRHRGMIVAVDAEGKTLFSLGEADARIFPRSACKAMQALPLIES
GAADAYGFGDRELALACSSHSGESEHVALAASMLAAAGRDVHALECGAHWSSDQKTLIAQ
ARSLEAPSALHNNCSGKHAGFVCACCHSGTEVKDYIGYDHPLQKEIRGVMTELTGAVLGR
DDCGIDGCSIPAYALSMRGLARGFAKMASGVGLGTERARASKRLIDACMAEPFYVAGSRR
ACTRLMKTAPGRIFAKTGAEGVFCAAIPEKGVGIALKCEDGTTRAAEAMVAATLARFFTE
DREIHAALMAQANHAMRNWNGMHVGDVRVVTEAFAA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatcccgttctggtcgaagtaacgcgcggaaatctggtcgaaagccgccatcga
ggcatgatcgtcgccgtcgatgccgaggggaagacactgttttcgctcggtgaagcggat
gctcgcatctttccgcgctcggcctgcaaggcaatgcaggccctgccgctgatcgaaagc
ggtgccgccgacgcctacgggttcggggaccgggaactggcacttgcctgctcctcgcat
tccggggagtcggaacatgtggcgctcgccgcctcgatgctcgcggcagcggggcgggac
gtccacgcgcttgaatgcggcgcccattggtcctccgaccagaagacgctgatcgcgcag
gcgcgctccctcgaagccccaagcgcactccacaacaattgctccggcaagcatgcgggc
tttgtctgtgcctgctgccattccggcaccgaggtcaaagattatatcggctacgaccac
ccgcttcagaaggagatccgcggggtcatgacggagctgacgggagctgtcctcggtcgc
gacgactgcggcatcgatggttgctcgattccggcctacgcgctctcgatgaggggtctt
gcccgcggctttgcaaagatggcgagcggagtcggcctcgggacggagcgggcccgggcc
tcgaagcgtctgatcgacgcctgcatggccgaacccttttatgttgccggttccaggcgt
gcctgcacacgccttatgaagacggctcccggccgaatctttgcgaagaccggcgccgaa
ggcgtcttctgtgcggcgatacccgaaaagggcgtcggcatcgcgctgaaatgcgaggac
ggcacgacccgtgccgccgaggcgatggtcgcggcaacgctcgctcggttctttacggaa
gatcgggagatccatgcggcgctgatggcgcaggccaatcacgcgatgcgcaactggaac
ggaatgcacgtcggggacgtacgggtggtgacggaggcctttgccgcctga

DBGET integrated database retrieval system