KEGG   Sinorhizobium medicae: Smed_0590Help
Entry
Smed_0590         CDS       T00555                                 

Definition
(RefSeq) cytochrome c class II
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C_2
Motif
Other DBs
NCBI-GeneID: 5321426
NCBI-ProteinID: YP_001326281
JGI: Smed0590
UniProt: A6U716
Position
638442..638888
Genome map
AA seq 148 aa AA seqDB search
MKIRALMLAAALAGLGVTAVTAADEPQAVRQQLMKKVGQATGALSGIAKGEKPYDAEIVK
ASLATISETVKVFPDHFPAGSETGMETEASPKIWENMADFKAKAAKLGGDAEKILAELPA
DQAGVGAALGIIGKDCSSCHESYRIKKD
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaagatacgagctcttatgcttgccgcggccctggcgggcctgggcgtgaccgccgtc
acggcggccgacgagccgcaggcggtgcgccagcaattgatgaaaaaagtcgggcaggcc
acaggtgcgctcagcggcatcgccaagggtgaaaagccctatgacgccgagatcgtaaaa
gcttcgctggcgacgatcagcgaaacggtgaaagtcttcccggatcacttcccggctggt
tccgagacagggatggaaaccgaagcgagcccgaagatctgggagaatatggcggacttc
aaggcgaaggccgccaagctcgggggggacgcagaaaaaatccttgctgaattgcccgcg
gatcaggccggcgtcggtgctgcactcggcatcatcggaaaagactgcagcagctgtcac
gagagctatcggatcaagaaggattga

DBGET integrated database retrieval system