KEGG   Sinorhizobium medicae: Smed_0610Help
Entry
Smed_0610         CDS       T00555                                 

Definition
(RefSeq) putative monovalent cation/H+ antiporter subunit D
  KO
K05568  multicomponent Na+:H+ antiporter subunit D
Organism
smd  Sinorhizobium medicae
Brite
Transporters [BR:smd02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Smed_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proton_antipo_M NADHdeh_related
Motif
Other DBs
NCBI-GeneID: 5321446
NCBI-ProteinID: YP_001326301
JGI: Smed0610
UniProt: A6U736
Position
658991..660553
Genome map
AA seq 520 aa AA seqDB search
MAVSTSAPVDLSAALVLTPTSAAEWLVVLPVAWCLAVGALLMMLRRWAILQPVIALAALA
VLVLIDVALLDHVARNGPTTMVMGRWLPPFGIAFTVDLTGALFALMAAAVAFAAGIFSLA
DINESGRRYGFYPLLMLLMAGVSGAFLTGDIFNLYVWFEVLLISSFGLLVLGSEREQIDG
TVKYGFLNLVATTLFLVATGFLYAVFGTLNMADIARKADELRAGAPLMTLVGLYVLAFGM
KAAAFPVNFWLPASYHTPRVVVSALFAGLLTKVGIYALIRVTVMLFPVEREELSFVLALI
GALTMMVGVLGALAQTDFRRILGYLVVSGIGSMVAGIAIGGPGGIGGAIFYALHSMLVMT
GLYFASGIAMRLGADSSISTLAGLYRKHVGFAALTLMLCFAVSGLPPFSGFWPKVMLVKA
ALDIGAWWLAAALLLVGFFTMIATGRLFLLAYWRESTRPDAGGTTRLPAKTFGPLAALTL
LALALGVYPEPLLAMIQNAAAGLAEPSAYLNSVFPAGGPQ
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttctacctccgctcccgtcgacctttccgcagcactggtgctgacccccaca
tcggctgccgaatggcttgtcgttctgccggtcgcgtggtgcctggctgtcggcgcgctc
ctcatgatgcttcgccgatgggccattctccagcctgtgatagccctggcggctctggcc
gtgctcgtgctgatcgacgtggcgctgctcgatcatgtcgcgcgaaacggtccgacgacg
atggtgatgggacgctggctgccgccgttcggtatcgccttcaccgtcgacctgaccgga
gcgctctttgctcttatggccgctgccgttgcgtttgccgccggcatcttttcgctggcc
gatatcaacgagagcggccggcgctacggtttctatccgctgctgatgctgctgatggcc
ggcgtttcgggagccttccttacgggagatatcttcaatctctatgtctggttcgaggtc
ctgctgatttcgtccttcggtcttctggtcctcggctccgagagggagcagatcgacggg
acggtgaaatacggatttctgaatctggtcgcgacgaccttgtttctcgtcgccaccggc
ttcctctacgccgtgttcggcacgctcaacatggccgacatcgcgcgcaaggctgacgaa
ctgcgcgccggtgcgccgctgatgacattggtcgggctctatgttcttgccttcggcatg
aaggcggccgcgtttccagtgaatttctggctgccggcttcctatcatacgcctcgcgtg
gtcgtgtcggcgctctttgcaggcctgcttaccaaggtcggtatttatgccctgatccgg
gtgactgtcatgctcttcccggtcgaaagggaggagctgagctttgtactggcgcttatc
ggcgcgctgacgatgatggtcggcgttctcggtgcgctcgcgcaaacggatttccgccgc
atcctcggctacctcgtcgtgtcgggcatcggctcgatggttgcaggcatcgccatcggc
ggaccaggcggcatcggcggcgcaattttctatgcactccattcgatgctggtgatgacg
ggcctgtattttgcttcagggattgccatgcgccttggcgcggatagctcgatctcgacg
cttgccggtctttaccgcaagcatgtcggatttgctgcgctcaccttgatgctgtgcttc
gccgtttcgggcctcccgcccttttccggcttctggccgaaggtcatgctggtgaaggca
gcgctcgacatcggcgcctggtggcttgccgccgcgctccttcttgtcggcttcttcacc
atgatagccacgggccggcttttcctcctggcctattggcgcgagagtacgagacctgac
gccggcggtacgacgcgcttgccggccaagactttcggtccgcttgccgcgcttacgctg
ctggcgctggcgcttggcgtctaccccgagccgctgcttgcgatgatccagaacgcggcg
gctggtctggccgagccctccgcttacctgaattcagtctttcccgccggaggtccgcaa
tga

DBGET integrated database retrieval system