KEGG   Sinorhizobium medicae: Smed_0640Help
Entry
Smed_0640         CDS       T00555                                 

Definition
(RefSeq) bifunctional glutamine-synthetase adenylyltransferase/deadenyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
smd  Sinorhizobium medicae
Brite
Enzymes [BR:smd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     Smed_0640
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     Smed_0640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase DUF294 HTH_18 DUF294_C
Motif
Other DBs
NCBI-GeneID: 5321476
NCBI-ProteinID: YP_001326331
JGI: Smed0640
UniProt: A6U766
Position
686506..689463
Genome map
AA seq 985 aa AA seqDB search
MAETVERSLSDIDVVPIRPASQADAKAALSVLKDAAKCSDRIAERIASGAPLKDFLVAAF
ALSPFLRDTAGGHPAVLEALLSETLPAFLKRRIEAARTAWRGEATGAALADTEIMMRLRR
AKREVAFAVALADLSRLFSARETTRWLSDFAEAAVSAAIDHLLLGAHESGKLELKDSSAP
SAGCGVVVLGMGKLGAGELNYSSDIDLVVFYDPQSSIITSRDDAPETFARLLRRLVRILQ
ERTGDGYVFRTDLRLRPDPGSTPLAIPVEAAMLYYESRGQNWERAAFIKARPIAGDLEAG
ERFVRELTPFVFRKYLDYAAIADIHSIKRQIHAHKGHGEIAVKGHNIKLGRGGIREIEFF
VQTQQLIAGGRTPALRLRETEAMLRMLAESGWIDGTTAEELTEAYWFLRDVEHRIQMVHD
EQTHLLPETEAELKRIAYMLGFEDTSSFSKALSGVLRTVERRYAQLFEQEVKLSAETGNL
VFTGEQDDPDTLETLKKLGFQRPSDIARIIRTWHYGRYRATQSVEARERLTELTPELLRF
FGESRRADEAFLRFDHFLSGLPAGIQLFSLLGNNPGLLSLIVNIMSSAPRLADIIAAKPH
VFDGMLEPGLLSELPTRDYLAPRIANFVAGGRHYEEVLDRLRIIAAEQRFLIGIRLLTGA
ITGLQAGRALTDLADLIIASALDAVLEEIRSVHGRFPGGRVAIVGMGKLGSHELTAGSDI
DLILLYDYDDEVLESDGAKPLDPVRYFTRVTQRLIAALSAPTAEGILYEVDMRLRPSGNK
GPVATRIAAFAKYQRTEAWTWEHLALTRARCICGDESLVGEAEAIFAEVLACKRDIAKIR
KDVEEMRGLIDKEKPPKDIWDFKLIPGGLVDIEFIAQYLTLIAPARGLTPPPAGTHTLEA
LKALGAGMMDANDLDTAAEALVLFTELSQLVRLCIDGDFDPKEAPAGLVDLVCRAGDYPD
LSHLEADIRRLSKAVRRIFHSVIAA
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaacggtcgagcggtctttgtccgatatcgatgtagtgccgattcgtcctgca
agccaggcagatgccaaggcggccctatccgttctcaaggatgcggcgaaatgcagtgat
aggattgcagagcgcattgcctccggcgcgccgctcaaggattttctcgttgccgccttc
gcgctttcgccgttcttgcgggataccgccggtgggcatccggcggttctcgaggcgctg
ctatccgaaacgctgccggcgtttttgaagcgcaggatcgaggctgcgcggacagcctgg
cggggcgaggcgaccggtgcggcgctcgcggacaccgagatcatgatgcgcttgaggcgg
gcgaagcgggaggtggccttcgccgtcgctctcgcggacctttcgcgtcttttcagcgcc
cgcgagacgacgcggtggctcagcgattttgcagaggcggccgtctcggctgcgatcgat
catttgctgctgggtgcgcatgaaagcgggaagctggaactgaaggacagctccgctccg
tcagccggctgcggtgttgtcgtgcttggcatgggcaagctcggcgccggtgagctcaac
tattcgtccgatatcgacctcgttgtcttctatgatccgcagtcgagcatcatcaccagt
cgcgatgatgctcccgagaccttcgcccggctgttgcggcgcctggtccgaattctgcag
gagaggaccggcgacggatatgtcttccgaacggacctgcggctgcggcccgacccgggt
tccacgccgcttgccattcccgtcgaggcggcaatgctctattacgagagcaggggccag
aattgggaacgcgccgccttcatcaaagcgcggccgatagcgggcgatctggaggcgggc
gaacggttcgtcagggagctgacgcccttcgtctttcgcaaatatctcgactatgccgcg
atcgccgacattcattcgatcaagcggcagatccatgcccataagggacatggcgaaatt
gccgtgaagggtcacaacatcaagctcgggcgaggcggcatccgggagatagagttcttc
gtccagacgcagcagctgattgccggtggccgcacgcccgcattgaggctgcgcgaaacc
gaagcgatgctgcgaatgctcgccgaaagcggctggatcgacggaacgacggctgaggag
ctcaccgaagcctattggttcctgcgcgacgtcgagcaccgcatccagatggtccacgac
gagcagacccatctcctcccggagaccgaagcggagctcaagaggatcgcctacatgctc
ggctttgaggacacctcgtccttctcgaaggcactttccggtgtgttacgaacggtcgag
cggcgctatgcgcagctcttcgaacaggaggtgaagctatccgccgaaaccggtaatctg
gttttcaccggagagcaggacgatcctgacacgctcgaaacgctgaagaagctcggtttc
cagcgaccgtccgacatagcgcgcatcatccgcacctggcattacggacgctaccgcgcg
acgcagtccgtcgaggcgcgcgagcggctgacggaactgacgccggagctcctgcgcttc
ttcggcgaaagccggcgagccgacgaagcgtttctgcggttcgaccatttcctctcgggg
ctgccggcggggatccagcttttctccctgctcggcaacaaccccgggctcctgtcgctg
atcgtcaacatcatgtcctcggcgccccgcctggccgatatcattgcggccaaaccgcat
gtcttcgatggcatgctggaaccgggcttgctttcggagctaccaaccagggattacctg
gcaccgcgcatcgcgaatttcgttgccggaggcaggcattacgaagaggtgctggaccgg
ctgcggatcatcgccgccgagcagcgctttctgatcggcatccggctcctcacgggtgcg
atcaccggtctgcaggcgggacgggcactcaccgacctcgccgatctgatcattgcctcg
gcgctcgatgcggtgctggaggagatccggtcggtgcatggccgcttccccggcgggagg
gtcgcaatcgttggaatgggcaagctgggcagccacgagttgacggccggctcagatatc
gacctcatcctgctctatgattatgacgacgaagtgctcgaatccgacggcgccaagccg
ctcgatccggtgcgctatttcacacgggtgacgcagcggctgatcgccgcgctgtcggcg
ccgacggccgagggcatcctctatgaagtcgacatgcggctgcggccctccggcaacaaa
gggcccgttgcgacacgcatcgcggcctttgccaaataccagcggacggaggcctggacc
tgggagcatctggcactgacgcgggcgcgctgcatctgcggcgatgaaagcctcgtcggc
gaagcggaggcgatcttcgctgaggttctcgcttgcaaacgggacatcgcgaagatccgc
aaggatgtggaggagatgcgcggactgatcgacaaggagaagccgccgaaggacatctgg
gacttcaagctgatacccggcggattggtcgatatcgaatttatcgcccagtacctcacc
ctgatcgctccggcgaggggcttgacccctcctcctgccgggacgcatacgctcgaggcg
ctgaaggcgcttggtgccgggatgatggatgcgaacgatctcgatacggccgccgaagcg
ctcgtgcttttcacggagctttcgcaactcgtgcgactttgcatcgatggcgacttcgat
ccgaaggaagcgccggccggtctcgtcgatctcgtctgccgcgccggggattaccccgac
ctctcacatctcgaagccgacattcgccgcctttcgaaggccgtacgccggatcttccat
tcagtcattgcggcgtga

DBGET integrated database retrieval system