KEGG   Sinorhizobium medicae: Smed_0653Help
Entry
Smed_0653         CDS       T00555                                 

Definition
(RefSeq) HxlR family transcriptional regulator
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HxlR HTH_20 MarR
Motif
Other DBs
NCBI-GeneID: 5321489
NCBI-ProteinID: YP_001326344
JGI: Smed0653
UniProt: A6U779
Position
706062..706463
Genome map
AA seq 133 aa AA seqDB search
MSRPRAKLTNTFPGCPVESALSFIDGKWKGVILYHLMSEGILRFNELRRRLPSVTPRMLT
RQLRELEEAALLSRTVFPVVPPRVDYALTARGESLKPVIMALKAWGDENVLCDGDRMTLK
PAESRSRPERKRA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtccccgcgcgaaactgacgaacacatttccgggctgtccagtggagtcggcc
ttgagcttcatcgacggcaaatggaagggcgtcattctctatcacctgatgagcgaaggc
atcctgcgcttcaacgagctgcgcagaaggctgccgagcgtgacgccacgtatgctgacc
aggcagttgcgtgaactggaggaggcggcgctgctgtcgcgcacggtctttccggtcgtt
ccgccgcgtgtcgactacgctttgacggcaaggggagaaagcctgaaaccggtgattatg
gccctgaaagcctggggcgacgagaatgttctctgcgacggagaccggatgacgctgaag
ccggccgaatcccgatcacggccggaacgcaaacgggcctga

DBGET integrated database retrieval system