KEGG   Sinorhizobium medicae: Smed_0656Help
Entry
Smed_0656         CDS       T00555                                 

Definition
(RefSeq) glycosyl transferase family protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 5321492
NCBI-ProteinID: YP_001326347
JGI: Smed0656
UniProt: A6U782
Position
complement(708995..709984)
Genome map
AA seq 329 aa AA seqDB search
MTEVLEGVELSIVVPVFNEEESVGPLVTRIRTAMAGFLEPWELILVDDGSTDRTLPNARK
ELSHQELRLKIIELQKNFGQTAAMQAGIDAAAGRLIVTLDGDLQNDPADIPHMVAAIEER
GLDLLVGWRQNRRDALILRKIPSWCANLLIGKITGVKLHDYGCSLKIYRGSVIKQVKLMG
EMHRFIPAWVAGVVPSSRIGEMPVTHHARHYGTSKYGISRTFRVVLDLLAVLFFMRYKAR
PGHFFGSIGLAAGGLSALILFYLAIDKFILGNDIGTRPMLIVGVMLFLSSIQLITTGILS
EMMARAYFRDNEPTSYIVRQTFVREPPHA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggtcctggagggcgtcgagctatccatagtggtaccggtgttcaacgaggaa
gagagcgtcgggccgctggtcacgcgtatcaggaccgcgatggccggatttctcgagccg
tgggagctcatcctcgttgatgacggcagcacggaccgaaccctcccgaatgcgcgcaag
gagctctcgcaccaggagctgcggctcaagatcatcgaactccagaagaatttcggccag
accgccgctatgcaggcgggcatcgacgctgccgccggccgcctgatcgttacgcttgac
ggcgatcttcagaacgatccggcggacattccccatatggtcgccgcgatcgaggagcgt
gggctcgacctccttgtcggctggcggcaaaaccggcgcgacgctctgatcctgcgcaag
attccctcctggtgcgccaatctcctgatcggcaagatcaccggcgtgaagttgcacgat
tacggctgcagcctcaagatctaccggggttccgtcatcaagcaggtgaagctgatgggg
gaaatgcaccgattcattccggcctgggtggcgggcgtcgtgccgagcagccggatcggc
gagatgccggtgacccatcatgcgcgccattacggcacctccaaatacgggatctcgcgc
acattccgggtcgtcctcgatctcctcgctgtcttgttcttcatgcgctacaaggcgcgg
cccgggcactttttcggctccatcgggctcgccgccggcggcctaagtgcgctgatcctg
ttctatcttgcaatagacaagttcatcctcggcaacgacatcggaacccggccgatgctg
atcgtcggagtgatgctgtttctctcctcgatccagctcattaccaccggcattctctcg
gaaatgatggcgcgcgcctatttccgtgacaatgaaccgacgagctacatcgtgcgccag
actttcgtgcgggagcccccgcatgcttga

DBGET integrated database retrieval system