KEGG   Sinorhizobium medicae: Smed_0675Help
Entry
Smed_0675         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NYN DUF2529
Motif
Other DBs
NCBI-GeneID: 5321512
NCBI-ProteinID: YP_001326366
JGI: Smed0675
UniProt: A6U7A1
Position
complement(727344..727925)
Genome map
AA seq 193 aa AA seqDB search
MMFDPREKIALFIDGANLYAASKSLGFDIDYRKLLKAFQKRGYLLRAYYYTALIEDQEYS
SIRPLIDWLDYNGYKVVTKPAKEFTDSLGRRKIKGNMDIELAIDAMEQSESVDHLVIFSG
DGDFTTLVEALQRKGRKVSVVSTMATQPPMIADDLRRQADHFIDLASLRAEIGREPSERV
QRPVEPVSDDVEL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatgttcgatcctcgcgagaaaatcgctcttttcatcgatggggccaatctctacgcc
gcgtcgaagagcctgggcttcgacatcgactatcgcaagctgctcaaggcattccagaaa
cgcggctacctgctgcgcgcctactactacaccgcgttgatcgaggatcaggaatattcg
tcgatccgcccgctgatcgactggctggactataacggctacaaggtcgtgaccaagccc
gccaaggaattcaccgactcgctcggtcgccgcaagatcaagggcaatatggacatcgaa
ctggcgatcgatgccatggagcaatccgaatcggtcgatcacctggtgatcttttccggc
gatggcgatttcaccacgctcgtggaagcgctccagcgtaagggccgcaaggtttccgtg
gtttccacgatggcgacccagccccccatgatcgccgacgacctgcgccgccaggccgac
cacttcatcgatctcgcctctctcagagccgaaatcggccgcgaaccgtcagaacgcgtt
cagcgtcccgtcgagccggtctccgacgacgtcgagctttag

DBGET integrated database retrieval system