KEGG   Sinorhizobium medicae: Smed_0767Help
Entry
Smed_0767         CDS       T00555                                 

Definition
(RefSeq) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
smd  Sinorhizobium medicae
Pathway
smd00230  Purine metabolism
smd00240  Pyrimidine metabolism
smd01100  Metabolic pathways
smd03030  DNA replication
smd03430  Mismatch repair
smd03440  Homologous recombination
Module
smd_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Smed_0767
   00240 Pyrimidine metabolism
    Smed_0767
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Smed_0767
   03430 Mismatch repair
    Smed_0767
   03440 Homologous recombination
    Smed_0767
Enzymes [BR:smd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Smed_0767
DNA replication proteins [BR:smd03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Smed_0767
DNA repair and recombination proteins [BR:smd03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Smed_0767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-GeneID: 5321604
NCBI-ProteinID: YP_001326458
JGI: Smed0767
UniProt: A6U7J3
Position
825314..825763
Genome map
AA seq 149 aa AA seqDB search
MTEVLFYHLTESKLEDALPPLLDKSIERGWRVVVQTVDAERRDALDTHLWVYRDDSFLPH
GTDAGDFATEQPILVVADHGNQNAATVRFLVDGAEPPPVSDYERVVFMFDGYDQQQLDAA
RDQWKRLKGEGHNLTYWQQNRDGRWEKKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagttcttttctaccacctgacggaatccaagctcgaggacgctttgccgccg
ctgctcgacaagagcattgagcgcggctggcgggtggtcgtgcagactgtcgatgcggaa
cggcgcgacgctctggatacgcatctatgggtctatcgagacgatagcttcctgccgcac
ggcacggatgcgggcgatttcgccaccgagcagcctattcttgtcgttgccgatcacggc
aatcagaatgccgcgaccgtgcgctttctcgtcgacggagcggagccgcctccggtttcc
gactacgagcgggtggtcttcatgttcgacggctacgaccagcagcagctcgatgccgct
cgcgatcagtggaagcggctcaaaggcgagggccacaacctcacctattggcagcagaac
cgtgacggaagatgggagaagaaggcatga

DBGET integrated database retrieval system