KEGG   Sinorhizobium medicae: Smed_0908Help
Entry
Smed_0908         CDS       T00555                                 

Definition
FAD-dependent pyridine nucleotide-disulfide oxidoreductase
Orthology
K00529  
3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin reductase subunit [EC:1.18.1.3]
Organism
smd  Sinorhizobium medicae
Pathway
Fatty acid degradation
Phenylalanine metabolism
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Smed_0908
  Lipid metabolism
   00071 Fatty acid degradation
    Smed_0908
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Smed_0908
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     Smed_0908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
980177..981469
Genome map
AA seq 430 aa AA seqDB search
MPERIVIIGGGQAGGRVAQILANSSADFHISLIGREPHPPYNRPPLSKGVLLAKSGFEDC
AIWREGDGAAGKIRFHAGVAAKMIDTGAKNVGLDDGRVIEYDRLVLATGSRVRRVSMPGA
DCSGVYMLRTFDDAVKIAKQFHSGLRLVVVGGGFIGLEIAAAARTRGLHTVVVEATNRLL
SRIAPQSIGDALARHHEQAGVSFRVGCMVERLISTRSGKLKSALLSNGETIPCDLAIVGV
GVTADTELAASAGLDVQVGIRTDATLRTSDPNIFACGDAVSFWHPLFERHVRVEAWQNAE
DHARVVAGRLMGQETICDTVPFFWSDQYELSMQIVGLPQYGSFVVSHATEDAQILYHLDP
RGRLVGATGLGPHQLIGRKIRAARQAIAGRSCPDAQALKGGLIRSDAPPESGNLEREEEN
PAPFSARIPL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagagaatagtcatcatcggcggcggtcaggcgggagggcgcgtcgcacagatt
ctggcaaattcgtcggcggattttcacatctccctcatcggccgagagccgcaccccccg
tacaaccgcccccctctgtccaagggcgtactcctggcgaagtccggcttcgaggattgc
gcgatctggcgagagggcgatggagcggctggtaaaatccggtttcatgctggcgtagct
gcgaagatgatcgatacaggcgcgaagaacgtcggcttggatgacggccgcgtaatcgaa
tatgacaggctggtccttgccaccggatcgcgcgtccggcgggtgtcgatgccgggcgcc
gattgttccggcgtgtacatgctgcggactttcgacgatgcggttaaaatcgcgaaacag
tttcacagcggcctacgtctcgtggtggttggaggcggcttcatagggcttgagatcgca
gccgccgcgcgtacgcgcggactgcacacggtcgtcgtcgaagcgaccaatcggctgctg
tcccgcatcgcgccgcaaagcatcggcgacgcccttgcgcggcatcacgaacaggcgggc
gtttcgtttcgcgtcggatgcatggtcgagcggttgatctccacccgttccggcaaattg
aagtcggctcttttgtccaatggagaaacgatcccctgcgacctggccattgtcggtgtg
ggggtcaccgccgataccgaattggcagcaagtgcgggtctcgacgtacaggtcggtata
agaaccgatgcgacgcttcgaacttcagatccgaatatcttcgcctgtggcgatgcggtt
tccttctggcaccccttgttcgagcggcatgtccgggtggaggcatggcaaaatgccgag
gatcacgcacgtgtggtggcgggacggctgatgggccaggagacgatctgtgacaccgtc
cccttcttctggtcggaccagtacgaactatcgatgcagatcgttggcctgccgcagtac
ggcagctttgtcgtgtcgcacgcgaccgaggatgcgcagatcctgtatcatctggacccg
cgcggccgtctcgtcggtgcgaccggccttgggccgcaccaactgatcggaaggaagatc
agagcagcgcgtcaagcaatcgccgggcgcagctgcccggatgcgcaggcgctcaagggt
ggcctgatccggtcggatgcgccgcccgaaagcggcaacctcgagcgggaggaggaaaac
cctgcgccgttttccgcccgcatcccgctctaa

DBGET integrated database retrieval system