KEGG   Sinorhizobium medicae: Smed_0908Help
Entry
Smed_0908         CDS       T00555                                 

Definition
FAD-dependent pyridine nucleotide-disulfide oxidoreductase
Orthology
K00529  
ferredoxin--NAD+ reductase [EC:1.18.1.3]
Organism
smd  Sinorhizobium medicae
Pathway
Fatty acid degradation
Phenylalanine metabolism
Xylene degradation
Aminobenzoate degradation
Ethylbenzene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:smd01220]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:smd00071]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:smd00360]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:smd00627]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:smd00622]
Metabolism; Xenobiotics biodegradation and metabolism; Ethylbenzene degradation [PATH:smd00642]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
980177..981469
Genome map
AA seq 430 aa AA seqDB search
MPERIVIIGGGQAGGRVAQILANSSADFHISLIGREPHPPYNRPPLSKGVLLAKSGFEDC
AIWREGDGAAGKIRFHAGVAAKMIDTGAKNVGLDDGRVIEYDRLVLATGSRVRRVSMPGA
DCSGVYMLRTFDDAVKIAKQFHSGLRLVVVGGGFIGLEIAAAARTRGLHTVVVEATNRLL
SRIAPQSIGDALARHHEQAGVSFRVGCMVERLISTRSGKLKSALLSNGETIPCDLAIVGV
GVTADTELAASAGLDVQVGIRTDATLRTSDPNIFACGDAVSFWHPLFERHVRVEAWQNAE
DHARVVAGRLMGQETICDTVPFFWSDQYELSMQIVGLPQYGSFVVSHATEDAQILYHLDP
RGRLVGATGLGPHQLIGRKIRAARQAIAGRSCPDAQALKGGLIRSDAPPESGNLEREEEN
PAPFSARIPL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagagaatagtcatcatcggcggcggtcaggcgggagggcgcgtcgcacagatt
ctggcaaattcgtcggcggattttcacatctccctcatcggccgagagccgcaccccccg
tacaaccgcccccctctgtccaagggcgtactcctggcgaagtccggcttcgaggattgc
gcgatctggcgagagggcgatggagcggctggtaaaatccggtttcatgctggcgtagct
gcgaagatgatcgatacaggcgcgaagaacgtcggcttggatgacggccgcgtaatcgaa
tatgacaggctggtccttgccaccggatcgcgcgtccggcgggtgtcgatgccgggcgcc
gattgttccggcgtgtacatgctgcggactttcgacgatgcggttaaaatcgcgaaacag
tttcacagcggcctacgtctcgtggtggttggaggcggcttcatagggcttgagatcgca
gccgccgcgcgtacgcgcggactgcacacggtcgtcgtcgaagcgaccaatcggctgctg
tcccgcatcgcgccgcaaagcatcggcgacgcccttgcgcggcatcacgaacaggcgggc
gtttcgtttcgcgtcggatgcatggtcgagcggttgatctccacccgttccggcaaattg
aagtcggctcttttgtccaatggagaaacgatcccctgcgacctggccattgtcggtgtg
ggggtcaccgccgataccgaattggcagcaagtgcgggtctcgacgtacaggtcggtata
agaaccgatgcgacgcttcgaacttcagatccgaatatcttcgcctgtggcgatgcggtt
tccttctggcaccccttgttcgagcggcatgtccgggtggaggcatggcaaaatgccgag
gatcacgcacgtgtggtggcgggacggctgatgggccaggagacgatctgtgacaccgtc
cccttcttctggtcggaccagtacgaactatcgatgcagatcgttggcctgccgcagtac
ggcagctttgtcgtgtcgcacgcgaccgaggatgcgcagatcctgtatcatctggacccg
cgcggccgtctcgtcggtgcgaccggccttgggccgcaccaactgatcggaaggaagatc
agagcagcgcgtcaagcaatcgccgggcgcagctgcccggatgcgcaggcgctcaagggt
ggcctgatccggtcggatgcgccgcccgaaagcggcaacctcgagcgggaggaggaaaac
cctgcgccgttttccgcccgcatcccgctctaa

DBGET integrated database retrieval system