KEGG   Sinorhizobium medicae: Smed_0954Help
Entry
Smed_0954         CDS       T00555                                 

Definition
(RefSeq) 3-dehydroquinate dehydratase
  KO
K03786  3-dehydroquinate dehydratase II [EC:4.2.1.10]
Organism
smd  Sinorhizobium medicae
Pathway
smd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smd01100  Metabolic pathways
smd01110  Biosynthesis of secondary metabolites
smd01130  Biosynthesis of antibiotics
smd01230  Biosynthesis of amino acids
Module
smd_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Smed_0954
Enzymes [BR:smd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.10  3-dehydroquinate dehydratase
     Smed_0954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHquinase_II
Motif
Other DBs
NCBI-GeneID: 5321795
NCBI-ProteinID: YP_001326643
JGI: Smed0954
UniProt: A6U828
Position
complement(1028226..1028672)
Genome map
AA seq 148 aa AA seqDB search
MASTIFVLNGPNLNALGKREPGIYGGKTLADIEAMCKAEAKLLGFDIDFRQSNHEGTLVD
WLHEAGEKSVGIAINPAAYGHTSIAMHDAIRAITVPVVELHLSNIHAREEFRHKSMIAPA
VKGVICGFGAQSYILALHALKNLTEKSK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgactatctttgtgctgaacggcccaaacctgaacgcgctcggcaaacgcgaa
ccgggtatctatggcggcaagacgcttgccgacatagaggccatgtgcaaggcggaggca
aagctcctggggtttgatatcgacttccgccagtcgaatcatgagggcacgctggtcgac
tggttacacgaagctggggaaaaatccgtcggcatcgcgatcaacccagccgcctacgga
cacacctctatcgccatgcacgatgccattcgtgcgattactgtcccggtggtggaactg
catctttcgaatattcacgcgcgcgaggaattccggcataagtcgatgatcgcgccagcc
gtcaaaggcgttatctgcggcttcggcgctcagagttacattctggcgctgcatgcgtta
aagaacctgacggaaaaatccaaataa

DBGET integrated database retrieval system