KEGG   Sinorhizobium medicae: Smed_0954Help
Entry
Smed_0954         CDS       T00555                                 

Definition
3-dehydroquinate dehydratase
Orthology
K03786  
3-dehydroquinate dehydratase II [EC:4.2.1.10]
Organism
smd  Sinorhizobium medicae
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smd01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:smd00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1028226..1028672)
Genome map
AA seq 148 aa AA seqDB search
MASTIFVLNGPNLNALGKREPGIYGGKTLADIEAMCKAEAKLLGFDIDFRQSNHEGTLVD
WLHEAGEKSVGIAINPAAYGHTSIAMHDAIRAITVPVVELHLSNIHAREEFRHKSMIAPA
VKGVICGFGAQSYILALHALKNLTEKSK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgactatctttgtgctgaacggcccaaacctgaacgcgctcggcaaacgcgaa
ccgggtatctatggcggcaagacgcttgccgacatagaggccatgtgcaaggcggaggca
aagctcctggggtttgatatcgacttccgccagtcgaatcatgagggcacgctggtcgac
tggttacacgaagctggggaaaaatccgtcggcatcgcgatcaacccagccgcctacgga
cacacctctatcgccatgcacgatgccattcgtgcgattactgtcccggtggtggaactg
catctttcgaatattcacgcgcgcgaggaattccggcataagtcgatgatcgcgccagcc
gtcaaaggcgttatctgcggcttcggcgctcagagttacattctggcgctgcatgcgtta
aagaacctgacggaaaaatccaaataa

DBGET integrated database retrieval system