KEGG   Sinorhizobium medicae: Smed_1037Help
Entry
Smed_1037         CDS       T00555                                 

Definition
(RefSeq) L-serine dehydratase 1
  KO
K01752  
L-serine dehydratase [EC:4.3.1.17]
Organism
smd  Sinorhizobium medicae
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smed_1037
   01230 Biosynthesis of amino acids
    Smed_1037
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smed_1037
   00270 Cysteine and methionine metabolism
    Smed_1037
Enzymes [BR:smd01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     Smed_1037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1107368..1108768
Genome map
AA seq 466 aa AA seqDB search
MFLSVFDVFKIGIGPSSSHTMGPMSAANRFLDLILSDEWPRPSNAAVAAIQVSLHGSLAH
TGIGHGSGRAVILGLMGERPDLVDPDKMDEVIEEVERTGRITPPGHPSYAFQPKADLVFD
KKMALPGHANGMSFSAFDRDGRLLLKRIYYSIGGGFVVTDTELGAMRAQKNKTAGVKVPY
PFATAQQMLDMAARSGMSIAQMKRANEECSMSRQELDNGLDRIWAAMNSCIDRGLSQDGI
MPGGLKVRRRARAIHDKLQEEWRSNKVNPLLANDWLSVYAMAVNEENAAGGRVVTSPTNG
AAGVVPATIRYYLHFHEDADQDGIRDYLLTAAAVGGIIKHNASISGAEVGCQGEVGSASA
MAAAGLAAVMGGTPEQIENAAEIALEHHLGMTCDPVAGLVQVPCIERNALGAVKAVTAAS
LALKGDGKHFVPLDACIETMRQTGVDMNEKYKETSTGGLAVNVVEC
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtttctttccgtcttcgacgtattcaagatcggtatcggcccgtcgagctcacatacg
atggggccgatgtcggcggcgaacaggtttctcgatcttattctttcggacgaatggccg
cggccctccaacgcagctgttgccgctatccaggtcagccttcatggttcgctggcgcat
acgggaatcggccatggatcgggcagggcggttattctcggcctgatgggcgaacgcccc
gatctcgtggatccggacaagatggacgaggtaatcgaggaggtggagcgcacagggcgt
atcacgccgcctggacatccttcctatgcattccagcctaaggcggatctggttttcgac
aagaagatggcgctgcctggccatgccaacggcatgtccttctccgccttcgaccgcgac
ggccggctgcttctgaaacgcatctactattcgatcggtggcggcttcgtcgttactgat
acggagctcggcgcgatgagagctcagaagaacaagacggccggcgtcaaagtgccgtat
ccctttgccaccgcacagcagatgctcgacatggccgcccgttccggaatgagcatcgct
cagatgaaacgggccaacgaagaatgcagcatgtcgaggcaggagctcgacaacgggctc
gaccgcatttgggcggcaatgaacagttgcatcgaccgcgggctcagccaggacggcatc
atgccgggcgggctaaaggttcgccgccgcgccagggcaatccacgacaagctccaggag
gagtggcgttccaacaaggttaatcctctactcgccaacgattggctgagcgtctatgcg
atggcggtcaacgaggagaatgccgccggtggccgggtggtgacgtcgcctacgaacggg
gcggcaggtgtcgtcccggcgacgatccgctactatcttcattttcacgaggatgccgac
caggacggtatccgcgactatctgctgactgccgcggcggttggcggtatcataaagcac
aacgcctctatttccggggcggaggtcggctgtcagggcgaagttggatccgcgtcggcg
atggccgccgcgggccttgcagcggtgatgggcggaacgccggagcagatcgagaatgcg
gccgaaatcgccctcgaacaccaccttggaatgacctgcgatccggtcgcaggcctcgtc
caggtgccttgcatcgagcgtaacgcccttggtgccgtcaaggcggtcacggccgcctcg
ctcgcccttaagggcgatggcaagcatttcgtgccgctcgatgcctgtatcgagacgatg
cgccaaaccggcgtggacatgaacgaaaagtacaaggaaacatcgacgggcggtctcgcg
gtcaacgtcgtggagtgttaa

DBGET integrated database retrieval system