KEGG   Sinorhizobium medicae: Smed_1037Help
Entry
Smed_1037         CDS       T00555                                 

Definition
L-serine dehydratase 1
Orthology
K01752  
L-serine dehydratase [EC:4.3.1.17]
Organism
smd  Sinorhizobium medicae
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:smd01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:smd01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:smd00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:smd00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1107368..1108768
Genome map
AA seq 466 aa AA seqDB search
MFLSVFDVFKIGIGPSSSHTMGPMSAANRFLDLILSDEWPRPSNAAVAAIQVSLHGSLAH
TGIGHGSGRAVILGLMGERPDLVDPDKMDEVIEEVERTGRITPPGHPSYAFQPKADLVFD
KKMALPGHANGMSFSAFDRDGRLLLKRIYYSIGGGFVVTDTELGAMRAQKNKTAGVKVPY
PFATAQQMLDMAARSGMSIAQMKRANEECSMSRQELDNGLDRIWAAMNSCIDRGLSQDGI
MPGGLKVRRRARAIHDKLQEEWRSNKVNPLLANDWLSVYAMAVNEENAAGGRVVTSPTNG
AAGVVPATIRYYLHFHEDADQDGIRDYLLTAAAVGGIIKHNASISGAEVGCQGEVGSASA
MAAAGLAAVMGGTPEQIENAAEIALEHHLGMTCDPVAGLVQVPCIERNALGAVKAVTAAS
LALKGDGKHFVPLDACIETMRQTGVDMNEKYKETSTGGLAVNVVEC
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtttctttccgtcttcgacgtattcaagatcggtatcggcccgtcgagctcacatacg
atggggccgatgtcggcggcgaacaggtttctcgatcttattctttcggacgaatggccg
cggccctccaacgcagctgttgccgctatccaggtcagccttcatggttcgctggcgcat
acgggaatcggccatggatcgggcagggcggttattctcggcctgatgggcgaacgcccc
gatctcgtggatccggacaagatggacgaggtaatcgaggaggtggagcgcacagggcgt
atcacgccgcctggacatccttcctatgcattccagcctaaggcggatctggttttcgac
aagaagatggcgctgcctggccatgccaacggcatgtccttctccgccttcgaccgcgac
ggccggctgcttctgaaacgcatctactattcgatcggtggcggcttcgtcgttactgat
acggagctcggcgcgatgagagctcagaagaacaagacggccggcgtcaaagtgccgtat
ccctttgccaccgcacagcagatgctcgacatggccgcccgttccggaatgagcatcgct
cagatgaaacgggccaacgaagaatgcagcatgtcgaggcaggagctcgacaacgggctc
gaccgcatttgggcggcaatgaacagttgcatcgaccgcgggctcagccaggacggcatc
atgccgggcgggctaaaggttcgccgccgcgccagggcaatccacgacaagctccaggag
gagtggcgttccaacaaggttaatcctctactcgccaacgattggctgagcgtctatgcg
atggcggtcaacgaggagaatgccgccggtggccgggtggtgacgtcgcctacgaacggg
gcggcaggtgtcgtcccggcgacgatccgctactatcttcattttcacgaggatgccgac
caggacggtatccgcgactatctgctgactgccgcggcggttggcggtatcataaagcac
aacgcctctatttccggggcggaggtcggctgtcagggcgaagttggatccgcgtcggcg
atggccgccgcgggccttgcagcggtgatgggcggaacgccggagcagatcgagaatgcg
gccgaaatcgccctcgaacaccaccttggaatgacctgcgatccggtcgcaggcctcgtc
caggtgccttgcatcgagcgtaacgcccttggtgccgtcaaggcggtcacggccgcctcg
ctcgcccttaagggcgatggcaagcatttcgtgccgctcgatgcctgtatcgagacgatg
cgccaaaccggcgtggacatgaacgaaaagtacaaggaaacatcgacgggcggtctcgcg
gtcaacgtcgtggagtgttaa

DBGET integrated database retrieval system