KEGG   Sinorhizobium medicae: Smed_1037Help
Entry
Smed_1037         CDS       T00555                                 

Definition
L-serine dehydratase 1
Orthology
K01752  
L-serine dehydratase [EC:4.3.1.17]
Organism
smd  Sinorhizobium medicae
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smed_1037
   01230 Biosynthesis of amino acids
    Smed_1037
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smed_1037
   00270 Cysteine and methionine metabolism
    Smed_1037
Enzymes [BR:smd01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     Smed_1037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1107368..1108768
Genome map
AA seq 466 aa AA seqDB search
MFLSVFDVFKIGIGPSSSHTMGPMSAANRFLDLILSDEWPRPSNAAVAAIQVSLHGSLAH
TGIGHGSGRAVILGLMGERPDLVDPDKMDEVIEEVERTGRITPPGHPSYAFQPKADLVFD
KKMALPGHANGMSFSAFDRDGRLLLKRIYYSIGGGFVVTDTELGAMRAQKNKTAGVKVPY
PFATAQQMLDMAARSGMSIAQMKRANEECSMSRQELDNGLDRIWAAMNSCIDRGLSQDGI
MPGGLKVRRRARAIHDKLQEEWRSNKVNPLLANDWLSVYAMAVNEENAAGGRVVTSPTNG
AAGVVPATIRYYLHFHEDADQDGIRDYLLTAAAVGGIIKHNASISGAEVGCQGEVGSASA
MAAAGLAAVMGGTPEQIENAAEIALEHHLGMTCDPVAGLVQVPCIERNALGAVKAVTAAS
LALKGDGKHFVPLDACIETMRQTGVDMNEKYKETSTGGLAVNVVEC
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtttctttccgtcttcgacgtattcaagatcggtatcggcccgtcgagctcacatacg
atggggccgatgtcggcggcgaacaggtttctcgatcttattctttcggacgaatggccg
cggccctccaacgcagctgttgccgctatccaggtcagccttcatggttcgctggcgcat
acgggaatcggccatggatcgggcagggcggttattctcggcctgatgggcgaacgcccc
gatctcgtggatccggacaagatggacgaggtaatcgaggaggtggagcgcacagggcgt
atcacgccgcctggacatccttcctatgcattccagcctaaggcggatctggttttcgac
aagaagatggcgctgcctggccatgccaacggcatgtccttctccgccttcgaccgcgac
ggccggctgcttctgaaacgcatctactattcgatcggtggcggcttcgtcgttactgat
acggagctcggcgcgatgagagctcagaagaacaagacggccggcgtcaaagtgccgtat
ccctttgccaccgcacagcagatgctcgacatggccgcccgttccggaatgagcatcgct
cagatgaaacgggccaacgaagaatgcagcatgtcgaggcaggagctcgacaacgggctc
gaccgcatttgggcggcaatgaacagttgcatcgaccgcgggctcagccaggacggcatc
atgccgggcgggctaaaggttcgccgccgcgccagggcaatccacgacaagctccaggag
gagtggcgttccaacaaggttaatcctctactcgccaacgattggctgagcgtctatgcg
atggcggtcaacgaggagaatgccgccggtggccgggtggtgacgtcgcctacgaacggg
gcggcaggtgtcgtcccggcgacgatccgctactatcttcattttcacgaggatgccgac
caggacggtatccgcgactatctgctgactgccgcggcggttggcggtatcataaagcac
aacgcctctatttccggggcggaggtcggctgtcagggcgaagttggatccgcgtcggcg
atggccgccgcgggccttgcagcggtgatgggcggaacgccggagcagatcgagaatgcg
gccgaaatcgccctcgaacaccaccttggaatgacctgcgatccggtcgcaggcctcgtc
caggtgccttgcatcgagcgtaacgcccttggtgccgtcaaggcggtcacggccgcctcg
ctcgcccttaagggcgatggcaagcatttcgtgccgctcgatgcctgtatcgagacgatg
cgccaaaccggcgtggacatgaacgaaaagtacaaggaaacatcgacgggcggtctcgcg
gtcaacgtcgtggagtgttaa

DBGET integrated database retrieval system