KEGG   Sinorhizobium medicae: Smed_1067Help
Entry
Smed_1067         CDS       T00555                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
smd  Sinorhizobium medicae
Pathway
smd00010  Glycolysis / Gluconeogenesis
smd00051  Fructose and mannose metabolism
smd00562  Inositol phosphate metabolism
smd00710  Carbon fixation in photosynthetic organisms
smd01100  Metabolic pathways
smd01110  Biosynthesis of secondary metabolites
smd01120  Microbial metabolism in diverse environments
smd01130  Biosynthesis of antibiotics
smd01200  Carbon metabolism
smd01230  Biosynthesis of amino acids
Module
smd_M00002  Glycolysis, core module involving three-carbon compounds
smd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smed_1067 (tpiA)
   00051 Fructose and mannose metabolism
    Smed_1067 (tpiA)
   00562 Inositol phosphate metabolism
    Smed_1067 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Smed_1067 (tpiA)
Enzymes [BR:smd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Smed_1067 (tpiA)
Exosome [BR:smd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Smed_1067 (tpiA)
  Exosomal proteins of bladder cancer cells
   Smed_1067 (tpiA)
  Exosomal proteins of melanoma cells
   Smed_1067 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 5321913
NCBI-ProteinID: YP_001326755
JGI: Smed1067
UniProt: A6U8E0
Position
1135120..1135890
Genome map
AA seq 256 aa AA seqDB search
MTPDIRPLVAGNWKMNGTRASLDQIKAIAEGVKGGLSARVDALICPPATLLYVATALCDD
SPLLIGAQDCHQKPSGAHTGEVSAEMIADCFGTHVIVGHSERRSDHGEGDALVCAKTEAA
HGAGLVAIVCIGETEGERKEGRTLDILKRQLAGSLPDQATAENTVIAYEPVWAIGTGLTP
TASDVEEAHAFMRRELVARFGAEGSKMRILYGGSVKPSNARELMGVTNVDGALIGGASLK
ADDFLAIYRAYEELTA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgatatccgcccgctcgtcgccggcaattggaagatgaatggaacgcgtgcg
tccctggaccagatcaaggcaatcgccgagggcgtgaaaggcggtctttccgcgagggtg
gacgcccttatctgcccgccggcaaccttgctctacgtcgcgacggcgctttgcgacgac
agcccgttgttgatcggcgcgcaggactgccatcagaaaccgtcgggagcccataccggc
gaagtctctgccgaaatgatcgcggattgcttcgggacccacgtgatcgtcggccattca
gagcggcgcagcgatcatggggagggagacgccctggtttgcgccaagaccgaagccgcg
cacggcgccggtctggtcgccatcgtatgcatcggcgagacggaaggggagcgcaaggag
ggccggacgctcgatattctgaagcgccagctcgccggaagcctcccggatcaggcgacg
gccgaaaacacggtaatcgcatatgagcccgtctgggcgatcggcaccggtctcacgccc
actgcatccgacgtcgaggaggcccatgccttcatgcgccgcgaactcgtggcgcgcttc
ggcgcggaaggcagcaagatgcggattctctatggagggtccgtcaaaccctcgaatgcc
agggaactcatgggggtcaccaatgtcgacggcgccctgatcggcggcgcgagcttgaaa
gcggatgatttcctcgccatctacagggcctatgaagaattgaccgcctga

DBGET integrated database retrieval system