KEGG   Sinorhizobium medicae: Smed_1067Help
Entry
Smed_1067         CDS       T00555                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
smd  Sinorhizobium medicae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smed_1067 (tpiA)
   01230 Biosynthesis of amino acids
    Smed_1067 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smed_1067 (tpiA)
   00051 Fructose and mannose metabolism
    Smed_1067 (tpiA)
   00562 Inositol phosphate metabolism
    Smed_1067 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Smed_1067 (tpiA)
Enzymes [BR:smd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Smed_1067 (tpiA)
Exosome [BR:smd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Smed_1067 (tpiA)
  Exosomal proteins of bladder cancer cells
   Smed_1067 (tpiA)
  Exosomal proteins of melanoma cells
   Smed_1067 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1135120..1135890
Genome map
AA seq 256 aa AA seqDB search
MTPDIRPLVAGNWKMNGTRASLDQIKAIAEGVKGGLSARVDALICPPATLLYVATALCDD
SPLLIGAQDCHQKPSGAHTGEVSAEMIADCFGTHVIVGHSERRSDHGEGDALVCAKTEAA
HGAGLVAIVCIGETEGERKEGRTLDILKRQLAGSLPDQATAENTVIAYEPVWAIGTGLTP
TASDVEEAHAFMRRELVARFGAEGSKMRILYGGSVKPSNARELMGVTNVDGALIGGASLK
ADDFLAIYRAYEELTA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgatatccgcccgctcgtcgccggcaattggaagatgaatggaacgcgtgcg
tccctggaccagatcaaggcaatcgccgagggcgtgaaaggcggtctttccgcgagggtg
gacgcccttatctgcccgccggcaaccttgctctacgtcgcgacggcgctttgcgacgac
agcccgttgttgatcggcgcgcaggactgccatcagaaaccgtcgggagcccataccggc
gaagtctctgccgaaatgatcgcggattgcttcgggacccacgtgatcgtcggccattca
gagcggcgcagcgatcatggggagggagacgccctggtttgcgccaagaccgaagccgcg
cacggcgccggtctggtcgccatcgtatgcatcggcgagacggaaggggagcgcaaggag
ggccggacgctcgatattctgaagcgccagctcgccggaagcctcccggatcaggcgacg
gccgaaaacacggtaatcgcatatgagcccgtctgggcgatcggcaccggtctcacgccc
actgcatccgacgtcgaggaggcccatgccttcatgcgccgcgaactcgtggcgcgcttc
ggcgcggaaggcagcaagatgcggattctctatggagggtccgtcaaaccctcgaatgcc
agggaactcatgggggtcaccaatgtcgacggcgccctgatcggcggcgcgagcttgaaa
gcggatgatttcctcgccatctacagggcctatgaagaattgaccgcctga

DBGET integrated database retrieval system