KEGG   Sinorhizobium medicae: Smed_1160Help
Entry
Smed_1160         CDS       T00555                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
smd  Sinorhizobium medicae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Smed_1160
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Smed_1160
Enzymes [BR:smd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Smed_1160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1237755..1238789
Genome map
AA seq 344 aa AA seqDB search
MQYAFRMSESKAFISGCKGLTLTQEERDFFAGERPWGFILFGRNIGEEEQICDLVASLRD
SIGNPGAPVLIDQEGGRVQRIRPPLVAQYPNGAAIGEIYRRDRELGVRAAWLMGRLHAFD
LMRFGITVDCLPVLDVPVPGSHDVIGNRAYGHDPATVTEIGRAMSEGLKAGGMLPVMKHM
PGHGRTFVDSHHSLPVVSAGLDELKSSDFLPFAAMKDEAMAMSAHMVFTAIDPDNPATTS
TKVVREIIRGHIGFDGLLMSDDVSMNALAGDMAARARGIIAAGLDLVLHCHGIMEEMKAV
ADVVPVISGERLRRAKAAEAAFREPDSSVEAALRTEFNAMFALA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatgcttttcgcatgagcgaatcaaaagcattcatttccggctgcaagggcctt
acgctgacgcaggaagagcgcgacttcttcgccggcgagcgcccatggggcttcattctc
ttcggacggaatatcggcgaggaagagcagatctgcgacctggtggcgagcctgcgcgac
agcataggtaacccgggagcaccggtgttgatcgatcaggagggcggccgtgttcagcgc
atacgcccgccgctcgtcgcgcaatatcccaatggcgcggcgatcggcgaaatctatcgc
cgggatcgtgaactcggtgtgcgtgccgcgtggctcatgggacgcctgcatgcgttcgac
ctgatgcgcttcggcatcacggtcgattgcctgccggtactcgacgtaccggttcccggg
agccacgacgtgatcggcaaccgcgcctatgggcatgatccggcgacggtcactgagatc
ggccgcgccatgagcgaagggttgaaggctgggggcatgctgccggtcatgaagcatatg
cccggtcacggccgaaccttcgtcgattcgcatcacagcctgccggtcgtcagcgccggc
ctcgatgaattgaagagtagcgattttcttccctttgcggcgatgaaggatgaagcgatg
gccatgtccgcgcacatggtcttcactgcaatcgacccggacaaccccgcaacgacctcc
acaaaggtcgttcgcgagatcattcgaggccatattggcttcgacggcctgttgatgtcc
gacgacgtttccatgaatgcccttgccggggacatggccgcacgcgcccgcggaataatc
gccgccggtcttgatctcgtattgcattgtcatggcattatggaggaaatgaaagctgtg
gcagatgtcgttccggtcatctccggggagaggctccgccgggctaaggctgccgaggca
gccttccgggaaccggacagttcggtcgaagctgcactgcgcacagagtttaacgcaatg
ttcgcgctcgcctag

DBGET integrated database retrieval system