KEGG   Sinorhizobium medicae: Smed_1169Help
Entry
Smed_1169         CDS       T00555                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
smd  Sinorhizobium medicae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1245925..1246578
Genome map
AA seq 217 aa AA seqDB search
MNARVSQQEGFAAMVLRLRSGGIVNHELLKAVEQTPRLLFAPPQYQDEVYSKRLIPLDCG
SFMEGCDMAVRLLHCLNLKSGQRILEVGTGSGFTAAVMGRIAERVLTIDRYQTLVASAQK
NLEKAGIRNVVVRQADGSAGVPGEGTFDRILITAAFNSLPRMFSDHLVSGGTLLVPIMMS
ETHCRIVRVNRTGSRFDREDLFDAPYLPIVPQVASFL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcacgggtttcccagcaggaggggtttgcagcgatggtgctgcggcttcgctcg
ggcggcatcgtcaaccatgagcttctgaaggccgtggagcagacgccccggctgcttttc
gctccgccgcaatatcaggacgaagtctactccaagcggctgatcccgctcgattgcggt
tccttcatggaaggctgcgacatggccgtccggcttttgcactgtctcaacctgaagtcc
ggccagcgtatactcgaggtcggaaccggcagcggctttacggcggccgttatggggcgg
atcgccgagcgcgtgctgacgatcgaccgatatcagacgctggtcgcatcggcgcaaaag
aacctggagaaggcgggcatccgcaacgtcgtcgtccggcaggcggatggtagcgcaggc
gttccgggcgagggcacgttcgaccgcatcctcattaccgctgcgttcaacagccttccg
cggatgttctctgatcacctcgtttccggtggtaccctgcttgtgccgatcatgatgagc
gaaacgcattgccggatcgttcgcgtcaaccgcaccggcagccgtttcgaccgggaagat
ctgttcgatgcgccttaccttccgatcgtcccccaggtagcgtcgttcctttag

DBGET integrated database retrieval system