KEGG   Sinorhizobium medicae: Smed_1409Help
Entry
Smed_1409         CDS       T00555                                 

Gene name
trpC
Definition
(RefSeq) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
smd  Sinorhizobium medicae
Pathway
smd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smd01100  Metabolic pathways
smd01110  Biosynthesis of secondary metabolites
smd01130  Biosynthesis of antibiotics
smd01230  Biosynthesis of amino acids
Module
smd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Smed_1409 (trpC)
Enzymes [BR:smd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Smed_1409 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-GeneID: 5322260
NCBI-ProteinID: YP_001327090
JGI: Smed1409
UniProt: A6U9C5
Position
1490892..1491707
Genome map
AA seq 271 aa AA seqDB search
MTDILRRIEAYKRGEIAAAKVRIPLAELKARIAEQSPPRGFRAALGAHREKGDFGLIAEI
KKASPSKGLIRPDFDPPELAKAYAAGGAACLSVLTDAPSFQGAPEFLTKAREACPLPALR
KDFMFDTYQVFEARAWGADCILLIMASLADDDARRLEEAAFALGMDVLVEVHDAEEMDRA
LRLSSPLVGINNRNLRTFEVDLAVSERLATMVSSDHLLVGESGVFTHEDCRRLEKSGITT
FLVGESLMRKDDVEAATRALLTGSANILAAE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacggacatcctgcgtcggatcgaagcctataagcgcggcgagatcgcggccgcgaaa
gtacgtattccgctggccgaattgaaggcgcggattgccgaacagtcgccgccgcgcgga
ttccgtgctgcactcggggcgcaccgggaaaaaggcgacttcggcttgatcgccgaaatc
aagaaggcgagcccgtcgaaaggattgatccggccggatttcgatcctccggaactggcg
aaggcctatgccgctggcggcgctgcctgtttgtccgtccttaccgacgcgccgagcttc
cagggtgcaccggagttcctgacgaaggcacgcgaggcctgcccgctcccggcgctgcgc
aaggacttcatgttcgacacctatcaggttttcgaagcgcgggcctggggtgccgattgc
attctgcttatcatggcgtcgcttgccgacgatgatgctcgccggctggaagaagctgca
ttcgcactcggcatggacgtccttgtcgaagtacacgacgcggaggaaatggatagagca
cttcgcttgtcatctccgctcgtcggtatcaataaccgtaatctcaggacgttcgaggtt
gaccttgccgtctccgaaaggctcgcgacgatggtctcctccgaccatctcctggtcggc
gagagcggcgttttcactcacgaagactgccgacgccttgagaagagcgggattaccacc
ttcctggtcggtgaaagcctgatgaggaaggacgacgtcgaggcggcaacgcgtgcgctg
ctgaccggctccgcaaacattctggcggcagagtga

DBGET integrated database retrieval system