KEGG   Sinorhizobium medicae: Smed_1532Help
Entry
Smed_1532         CDS       T00555                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
smd  Sinorhizobium medicae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Smed_1532
Enzymes [BR:smd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Smed_1532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1619378..1619902)
Genome map
AA seq 174 aa AA seqDB search
MSRNSEWPRAILGLGGNVGDPRRTMAHALRTLNMRPDCRIVEVSRLYRTPPWGKTDQDWF
FNACAEVETALEPEALLAACLDIERTMKRVRKERWGPRTIDIDLLTFADLSVESATLRLP
HPRMTERGFVLKPLSDFAAELNVEGRTVSEWLSLADVTGIELADENTEWWRVPD
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcaatagcgaatggccacgtgcgatacttggtctcggcggcaacgtcggcgat
ccccggcgaacaatggcacacgcattgcggacgcttaacatgcggccggactgcaggatt
gtcgaagtctcgcggctctaccgtacgccgccatggggcaaaacggatcaggattggttc
ttcaatgcttgcgcggaggtcgaaacggcgctcgagccggaagcattgcttgcggcttgc
ctcgatatcgagcggacgatgaagcgtgtgaggaaggagcggtgggggccgcggacgatc
gacatcgaccttctgaccttcgctgatctcagcgtggaaagcgccacgttgcgattgcct
cacccgaggatgacagaacgcggcttcgtgttgaagccgctttccgacttcgcggcagag
ctgaacgtggaggggcgaaccgtcagcgaatggttaagcctggctgatgtgaccggtatc
gagttggcagacgaaaacaccgagtggtggcgcgtgccggattga

DBGET integrated database retrieval system