KEGG   Sinorhizobium medicae: Smed_2019Help
Entry
Smed_2019         CDS       T00555                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
smd  Sinorhizobium medicae
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smd00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:smd00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2069156..2069719)
Genome map
AA seq 187 aa AA seqDB search
MTETERNPAILPKIVIVVAVALNGVIGREGDLPWRLPTDLKRFKAQTIGKPVIMGRKTWA
AIGRPLPGRPNIVVTRNRAFEAPGAEVAPSLEAALAVARERAAAIGADEICVIGGGEIYR
QSIGMADVLHVTEVQAEVDGDTRFPEIDPAVFEKVLEEDLQSGEKDSHAMHFVTWRRRTA
PSQETGA
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaacagaacggaacccggcgatcttaccgaagatcgttatcgtcgtcgccgtc
gcgttgaacggggtcatcggccgcgagggcgatctcccctggcggctgccgaccgatctc
aaacgcttcaaggcacaaacgatcggcaagccggtcatcatggggcggaagacctgggcg
gcaatcggcaggccgctgcccggccggccgaacatcgtcgtcacccgcaatcgcgccttc
gaggctcccggagccgaggtcgcgccctccctcgaggcggctcttgcggtcgcacgggag
cgggcggcggcgattggggccgatgagatttgcgttatcggcggcggcgagatctaccgc
cagtcaatcggcatggccgatgtcctccacgttaccgaagtgcaggccgaagtggatggc
gacacacgcttccccgagatcgacccggcggttttcgaaaaggtgctcgaagaagacctg
caaagcggcgagaaagacagtcacgctatgcatttcgtgacctggcggcgccgtactgcg
ccgtcgcaggagaccggggcctga

DBGET integrated database retrieval system