KEGG   Sinorhizobium medicae: Smed_2128Help
Entry
Smed_2128         CDS       T00555                                 

Definition
(RefSeq) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
smd  Sinorhizobium medicae
Pathway
smd00010  Glycolysis / Gluconeogenesis
smd00071  Fatty acid degradation
smd00350  Tyrosine metabolism
smd00625  Chloroalkane and chloroalkene degradation
smd00626  Naphthalene degradation
smd01100  Metabolic pathways
smd01110  Biosynthesis of secondary metabolites
smd01120  Microbial metabolism in diverse environments
smd01130  Biosynthesis of antibiotics
smd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smed_2128
  Lipid metabolism
   00071 Fatty acid degradation
    Smed_2128
  Amino acid metabolism
   00350 Tyrosine metabolism
    Smed_2128
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Smed_2128
   00626 Naphthalene degradation
    Smed_2128
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Smed_2128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-GeneID: 5322988
NCBI-ProteinID: YP_001327796
JGI: Smed2128
UniProt: A6UBD1
Position
complement(2193177..2194322)
Genome map
AA seq 381 aa AA seqDB search
MTITANWSYPTAVKFGAGRIKELADHCKALGMKKPLLITDRGLAPMPITQKALDILEAGG
LGRAIFADVDPNPNDKNLEAGVKAFRNGGHDGVVAFGGGSGLDLGKCVAFMAGQTRPVWD
FEDIGDWWTRASVEGIAPIVAVPTTAGTGSEVGRASVITNSASHVKKVIFHPKFLPGVTI
CDPELTVGMPEVITAGTGMDAFAHCLEAYSSPFYHPMSAGIALEGMRLVKEYLPRAYKDG
TDLEARANMMSAAAMGAVAFQKGLGAIHSLSHPIGAIYNTHHGMTNAVVMPPVLRFNRFA
IDEKIGRAAAYLGIAGGFDGFYDYVLRLREELGVPDKLSALGVGTDRIDEMAEMAIVDPT
AGGNPVELTLDAAKKLFAECI
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaccgccaactggagctatccgaccgccgtcaaattcggcgcgggccgcatc
aaggagctcgccgaccactgcaaggcgctcggcatgaagaagccgctcctgatcacagat
cgcggtctggcgccgatgccgatcacgcagaaggcgcttgacattctcgaggccggcggg
ctcggacgggcgatctttgccgacgtcgatcccaaccccaacgacaagaacctggaagcc
ggcgtgaaggcattccgaaatggcggccatgacggcgtcgtcgccttcggcggcggctcg
ggcctcgatctcggcaaatgcgtcgccttcatggccggacaaacgcggccggtctgggat
ttcgaggatatcggcgactggtggacgcgcgcgagcgtcgaaggcatcgctccgatcgtc
gccgttccgacgaccgccggcaccggttccgaggtgggccgcgccagcgtcatcaccaat
tcggcaagccacgtcaagaaggtgatcttccacccgaaattcctgccgggcgtgaccatc
tgcgatccggagctcaccgtcggtatgcccgaggtgatcaccgccggcacaggcatggac
gcctttgcccattgcctggaggcctattcgtcgcccttctatcatccgatgtcggcgggt
atagcgctggaggggatgcggctcgtcaaggaatacctgccgcgggcctacaaggacggt
acggatcttgaagcccgggcgaacatgatgagcgcggcggcgatgggagcggtcgcgttc
cagaaggggctcggcgcgatccactcgctgtcgcatcccatcggggcgatctataacacc
catcacggcatgaccaacgctgtggtgatgcccccggtcctgcggttcaaccgtttcgca
atcgatgagaagatcggtcgcgccgccgcctatctcggcattgccggcggcttcgacggt
ttctacgactatgtactgcggctgcgggaggaactcggcgttccggacaagctgtcggcg
cttggtgtcggcacggaccgtatcgacgagatggccgagatggcgatcgtcgatccgacg
gccggcggcaatcccgtcgagctgacgctcgatgccgcgaagaagctcttcgccgaatgc
atttga

DBGET integrated database retrieval system