KEGG   Sinorhizobium medicae: Smed_2150Help
Entry
Smed_2150         CDS       T00555                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
smd  Sinorhizobium medicae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smed_2150 (tpiA)
   01230 Biosynthesis of amino acids
    Smed_2150 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smed_2150 (tpiA)
   00051 Fructose and mannose metabolism
    Smed_2150 (tpiA)
   00562 Inositol phosphate metabolism
    Smed_2150 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Smed_2150 (tpiA)
Enzymes [BR:smd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Smed_2150 (tpiA)
Exosome [BR:smd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Smed_2150 (tpiA)
  Exosomal proteins of bladder cancer cells
   Smed_2150 (tpiA)
  Exosomal proteins of melanoma cells
   Smed_2150 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2219125..2219892)
Genome map
AA seq 255 aa AA seqDB search
MSKSGLWVGTSWKMNKTLAEAMVFADGLAAADATRDARIQRFVVPPFTAVRQVKERLNGT
SVKVGAQNMHWDDAGAWTGEISPMMLKDCGLDIVELGHSERREHFGETDRTVGLKTAAAV
KHGLVPLICIGETLAEREAGEADTVLRRQVEGALAFLGGAARTAPVLLAYEPVWAIGVNG
IPATAGYADARHKIIADVAQRALGVKVPVLYGGSVNPGNCEELIAEPHIDGLFIGRSAWE
VGGYLDILQRVARAI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtcggggctctgggtcggcacgagctggaagatgaacaagacgttggcggag
gccatggtcttcgccgatggtcttgcggccgcagacgcgacgcgcgacgcgcgcattcaa
cgcttcgtcgtccctccgttcacggccgtacgacaagtcaaggaaaggctgaacggaacc
agcgtcaaagtcggtgcgcagaacatgcattgggacgatgcgggagcctggaccggcgaa
atttcaccgatgatgctcaaggactgcggtctcgatatcgtcgagcttggtcacagcgaa
cggcgcgagcatttcggcgaaaccgaccgaaccgtgggcctgaaaaccgcggccgccgtg
aagcacggtctggtgccgttgatctgcatcggtgagacgctcgccgaacgcgaggcaggt
gaagcggacacggtgttgaggcgccaggtggaaggcgcccttgcattcctcgggggcgcg
gcaaggacggcccctgttctcctggcttacgagccggtctgggcgatcggcgtcaacggc
ataccggcgacagccggctacgccgacgcccgccacaagatcattgccgacgtcgctcag
cgtgcgctcggggtgaaggttccggtgctctatggcggcagtgtcaatcccggaaattgc
gaggaactgatcgctgagccgcacatcgacgggctcttcatcggccgctccgcctgggag
gttggcggctatctcgacatcttgcaacgcgtagcccgggcgatctga

DBGET integrated database retrieval system