KEGG   Sinorhizobium medicae: Smed_2150Help
Entry
Smed_2150         CDS       T00555                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
smd  Sinorhizobium medicae
Brite
Enzymes [BR:smd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     Smed_2150 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2219125..2219892)
Genome map
AA seq 255 aa AA seqDB search
MSKSGLWVGTSWKMNKTLAEAMVFADGLAAADATRDARIQRFVVPPFTAVRQVKERLNGT
SVKVGAQNMHWDDAGAWTGEISPMMLKDCGLDIVELGHSERREHFGETDRTVGLKTAAAV
KHGLVPLICIGETLAEREAGEADTVLRRQVEGALAFLGGAARTAPVLLAYEPVWAIGVNG
IPATAGYADARHKIIADVAQRALGVKVPVLYGGSVNPGNCEELIAEPHIDGLFIGRSAWE
VGGYLDILQRVARAI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtcggggctctgggtcggcacgagctggaagatgaacaagacgttggcggag
gccatggtcttcgccgatggtcttgcggccgcagacgcgacgcgcgacgcgcgcattcaa
cgcttcgtcgtccctccgttcacggccgtacgacaagtcaaggaaaggctgaacggaacc
agcgtcaaagtcggtgcgcagaacatgcattgggacgatgcgggagcctggaccggcgaa
atttcaccgatgatgctcaaggactgcggtctcgatatcgtcgagcttggtcacagcgaa
cggcgcgagcatttcggcgaaaccgaccgaaccgtgggcctgaaaaccgcggccgccgtg
aagcacggtctggtgccgttgatctgcatcggtgagacgctcgccgaacgcgaggcaggt
gaagcggacacggtgttgaggcgccaggtggaaggcgcccttgcattcctcgggggcgcg
gcaaggacggcccctgttctcctggcttacgagccggtctgggcgatcggcgtcaacggc
ataccggcgacagccggctacgccgacgcccgccacaagatcattgccgacgtcgctcag
cgtgcgctcggggtgaaggttccggtgctctatggcggcagtgtcaatcccggaaattgc
gaggaactgatcgctgagccgcacatcgacgggctcttcatcggccgctccgcctgggag
gttggcggctatctcgacatcttgcaacgcgtagcccgggcgatctga

DBGET integrated database retrieval system