KEGG   Sinorhizobium medicae: Smed_2410Help
Entry
Smed_2410         CDS       T00555                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
smd  Sinorhizobium medicae
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:smd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2485757..2486815)
Genome map
AA seq 352 aa AA seqDB search
MAWDEQKLNELKAKYGESHGGELFDPTFRKVADKIFTKSGTRLAPYSGIPTFLTAPQMPV
EAENPDFGNLQVAMIGVPMDLGVTNRPGARFGPRALRAIERIGPYNHVLGCAPVHDLRVA
DIGDVPFRSRYRLEISHEDIETRIHQIVDAGVVPLSVGGDHSITHPILKAVGRKQPVGMI
HIDAHCDTGGAFDLTKFHHGGPFRNAVLDGVLDPTRVVQIGIRGSAEYLWEFSYESGMTV
IHAEEVGGRGIPAIIEKAKKIVGDGPTYLSFDIDSLDPSFAPGTGTPEVGGLTTREVLEL
IRGLKGVNLVGGDVVEVAPQYDATTNTAHAGAQVLFEILSLMVFSPSVTAKG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcttgggatgaacagaaactcaacgaactgaaggcgaaatatggcgaaagccatggc
ggagagctctttgatccgacctttcgcaaggttgcggacaagatcttcacgaagagcggc
acgcggctggcaccctattccggcataccgacgttcctgaccgctccccagatgcctgtt
gaggccgagaatccggatttcggaaaccttcaggtggcgatgatcggcgttcccatggac
ctcggcgtcaccaatcgtccgggtgcgcgcttcgggccgcgggcgcttcgcgcgatcgag
cgcatcggcccctataaccacgtgctcggctgtgctcccgtgcatgatcttcgggtcgcc
gatatcggtgatgttcccttccgcagccgctaccggcttgaaatcagccacgaggacatc
gaaacgcggatccaccagatcgtcgatgcgggtgtcgtgccgctctcggtcggcggcgac
cattcgatcacgcatccgatcctcaaggccgtcggcaggaagcagccggtcggcatgatc
catatcgacgcgcattgcgataccggcggcgctttcgatctcaccaagttccaccacggc
ggcccgttccgcaacgccgttctcgacggtgtgctcgatccgacccgcgtcgtccagatc
ggcatccgtggttctgccgaatatctgtgggagttctcctacgagtccggcatgacggtc
attcatgcggaggaggtcggtgggcggggcattcccgcgatcatcgagaaggcaaagaag
atcgtcggcgatggcccgacctatctttccttcgatatcgacagccttgatccgagcttc
gcgcctggcaccggtacgcccgaagtcgggggcctgaccacccgtgaggtcctggagttg
atccgtgggctgaagggcgtcaatctcgtcggtggcgatgtcgtcgaagtggcgccgcaa
tacgacgcgaccaccaataccgctcacgccggcgcccaggtgctcttcgagatactgagc
ctgatggtcttcagtccgtccgttacagccaaaggctga

DBGET integrated database retrieval system