KEGG   Sinorhizobium medicae: Smed_2410Help
Entry
Smed_2410         CDS       T00555                                 

Definition
(RefSeq) putative agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
smd  Sinorhizobium medicae
Pathway
smd00330  Arginine and proline metabolism
smd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Smed_2410
Enzymes [BR:smd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Smed_2410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 5323271
NCBI-ProteinID: YP_001328077
JGI: Smed2410
UniProt: A6UC62
Position
complement(2485757..2486815)
Genome map
AA seq 352 aa AA seqDB search
MAWDEQKLNELKAKYGESHGGELFDPTFRKVADKIFTKSGTRLAPYSGIPTFLTAPQMPV
EAENPDFGNLQVAMIGVPMDLGVTNRPGARFGPRALRAIERIGPYNHVLGCAPVHDLRVA
DIGDVPFRSRYRLEISHEDIETRIHQIVDAGVVPLSVGGDHSITHPILKAVGRKQPVGMI
HIDAHCDTGGAFDLTKFHHGGPFRNAVLDGVLDPTRVVQIGIRGSAEYLWEFSYESGMTV
IHAEEVGGRGIPAIIEKAKKIVGDGPTYLSFDIDSLDPSFAPGTGTPEVGGLTTREVLEL
IRGLKGVNLVGGDVVEVAPQYDATTNTAHAGAQVLFEILSLMVFSPSVTAKG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcttgggatgaacagaaactcaacgaactgaaggcgaaatatggcgaaagccatggc
ggagagctctttgatccgacctttcgcaaggttgcggacaagatcttcacgaagagcggc
acgcggctggcaccctattccggcataccgacgttcctgaccgctccccagatgcctgtt
gaggccgagaatccggatttcggaaaccttcaggtggcgatgatcggcgttcccatggac
ctcggcgtcaccaatcgtccgggtgcgcgcttcgggccgcgggcgcttcgcgcgatcgag
cgcatcggcccctataaccacgtgctcggctgtgctcccgtgcatgatcttcgggtcgcc
gatatcggtgatgttcccttccgcagccgctaccggcttgaaatcagccacgaggacatc
gaaacgcggatccaccagatcgtcgatgcgggtgtcgtgccgctctcggtcggcggcgac
cattcgatcacgcatccgatcctcaaggccgtcggcaggaagcagccggtcggcatgatc
catatcgacgcgcattgcgataccggcggcgctttcgatctcaccaagttccaccacggc
ggcccgttccgcaacgccgttctcgacggtgtgctcgatccgacccgcgtcgtccagatc
ggcatccgtggttctgccgaatatctgtgggagttctcctacgagtccggcatgacggtc
attcatgcggaggaggtcggtgggcggggcattcccgcgatcatcgagaaggcaaagaag
atcgtcggcgatggcccgacctatctttccttcgatatcgacagccttgatccgagcttc
gcgcctggcaccggtacgcccgaagtcgggggcctgaccacccgtgaggtcctggagttg
atccgtgggctgaagggcgtcaatctcgtcggtggcgatgtcgtcgaagtggcgccgcaa
tacgacgcgaccaccaataccgctcacgccggcgcccaggtgctcttcgagatactgagc
ctgatggtcttcagtccgtccgttacagccaaaggctga

DBGET integrated database retrieval system