KEGG   Sinorhizobium medicae: Smed_2707Help
Entry
Smed_2707         CDS       T00555                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smd  Sinorhizobium medicae
Pathway
smd00040  Pentose and glucuronate interconversions
smd00052  Galactose metabolism
smd00500  Starch and sucrose metabolism
smd00520  Amino sugar and nucleotide sugar metabolism
smd01100  Metabolic pathways
smd01130  Biosynthesis of antibiotics
Module
smd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Smed_2707
   00052 Galactose metabolism
    Smed_2707
   00500 Starch and sucrose metabolism
    Smed_2707
   00520 Amino sugar and nucleotide sugar metabolism
    Smed_2707
Enzymes [BR:smd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Smed_2707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-GeneID: 5323576
NCBI-ProteinID: YP_001328372
JGI: Smed2707
UniProt: A6UD07
Position
complement(2815524..2816411)
Genome map
AA seq 295 aa AA seqDB search
MTDKRKVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPVIQYVVDEALEAGIEHLIFVT
GRSKAVIEDYFDIQVELDQTLRERNKKAEIELLEAMLPKAGTTSFTRQQAPLGLGHAVWC
ARELVGNEPFALLLPDMIMKGEKGCLKGMVELYEESGGNVVAVEECAPDQAHKYGIVGVG
ETVGDGFRITRMVEKPAKGTAPSNFFINGRYILQPEIFPILETQERGAGNEIQLTDGMVK
LAEAQAFAAYHFRGDTYDCGAKDGFILANVAFALERGDIRPTVEGPLKTLLQGLK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataagcgtaaagtccgcaaagccgttttccccgtcgcaggcctcgggacgcgt
ttccttcccgcgaccaaggcggtcccgaaggagatgctgacggtggtggacaagccggtc
atccaatatgttgtcgatgaagcgctggaagccggaatcgagcatctgattttcgtgacc
ggccggagcaaggccgtcatcgaggattatttcgacattcaggtcgaattggaccagacg
ctgcgcgagcgcaacaagaaggcggagatcgagctcctcgaagccatgctgccgaaggcc
ggcaccacgagcttcacccgccagcaggcgccgcttggcctcggacatgcggtctggtgc
gcccgcgagctcgtcggcaacgagcccttcgcgctgctcttgcccgacatgatcatgaag
ggagagaagggctgcctgaagggaatggtcgaactctatgaagagagcggcggcaacgtc
gtcgccgtcgaggaatgcgcgcccgaccaggcgcacaaatacgggatcgtcggagtgggc
gagaccgtcggcgacggcttcaggatcaccaggatggtcgagaagccggcaaaggggacg
gctccgtcgaatttcttcatcaacggccgctatatcctgcagccggagattttcccgatt
ctggaaacgcaggaacgcggcgccggcaatgagatccagttgaccgacggcatggtgaag
ctcgcagaagcacaggcctttgccgcctatcacttccgcggcgatacctatgattgcggc
gccaaggacggtttcattctggccaatgtcgccttcgctctcgagcgcggcgacatccgc
cccacggtcgagggaccgctcaagacgctgcttcagggcctgaagtga

DBGET integrated database retrieval system