KEGG   Sinorhizobium medicae: Smed_2747Help
Entry
Smed_2747         CDS       T00555                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
smd  Sinorhizobium medicae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Smed_2747
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smed_2747
  Lipid metabolism
   00071 Fatty acid degradation
    Smed_2747
  Amino acid metabolism
   00350 Tyrosine metabolism
    Smed_2747
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Smed_2747
   00626 Naphthalene degradation
    Smed_2747
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Smed_2747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2864933..2866144)
Genome map
AA seq 403 aa AA seqDB search
MKTGSPASRLTGDNGIYISSHELQTGGKSLKTRAALLRTSPVGRPYAHTRPLSIETIELD
PPGPDELLVKIGAAGLCHSDLSVINGDRPRPVPMVLGHEAAGTVEAVGSNVHDLAAGDRV
VMSFMPSCGHCLPCAEGRPALCLPGAEANGKGTLLSGERRLHCQDVPVNHHLGVSGFADY
SVVSRQSVVKIEADLPLVEAALFGCAVLTGVGAIVNTCRVRPGESVAVVGLGGVGLAALL
GAVAAGAERIVAVDLAEDKLKLALSLGATDTVLAADSDAAEKIRLATRGGVDHAVEAAGS
AKAFELAYHITRRGGLTVSAGLAHPSSQISIPAVSLVAEERSMRGSYMGSCVPARDIPRF
IALYQRGRLPVDRLLSSTGPLEEINEAFDLLDQGRVIRHVIEF
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacgggctctcccgcatctcgacttacgggagacaatggcatctatatttcctcg
cacgaactgcaaacgggaggaaagagcttgaagacacgtgcggcgctgctgaggacatca
cctgtcgggaggccctacgcccatacgaggccgctttcgatcgagacgatcgagctcgat
ccgccggggccggatgaattgctcgtgaagatcggggccgccggcctctgtcactccgac
ctgtcggtcatcaatggcgaccggccgcggccggtgccgatggtgcttgggcacgaggcc
gccgggacggtagaggcggtcggaagcaatgtgcatgatctcgccgccggcgaccgggtg
gtgatgagcttcatgccgagttgcgggcattgtctgccctgcgcggaagggcggccggca
ctctgccttcccggagcggaagcgaacggcaagggcactctgctttccggcgagcgccgg
ctgcattgccaggacgttccggtcaaccatcacctcggtgtttcgggttttgccgattat
tcggtggtttcccgccaatccgtcgtcaagatcgaggcggatctgccgttggtcgaggcg
gcgctgttcggctgtgccgtgctcaccggagtcggggcgatcgtcaatacgtgccgcgtg
cggccgggcgaatccgttgcggtcgtcgggctgggcggggtagggctggcggctcttctc
ggtgctgtcgccgccggtgccgagcgcatcgtcgcggtggatctcgcggaggacaagctg
aaactcgccctttcgctcggtgccacggataccgtcctggcggcagactctgacgcggcc
gaaaaaatccgcctcgcgacccgtggcggcgtcgatcatgcggtcgaggcggcgggctcc
gccaaggccttcgaacttgcctatcacatcacacggagaggagggctgacggtttccgcg
gggcttgctcatccttcgagccagatctccatcccggcagtgagcctcgttgcggaagag
cgcagtatgcgcggaagttacatgggaagctgtgtgcccgcgcgcgacattccgcggttc
atcgcgctctatcagcgcggcaggctgcccgtcgaccggttactgtccagcacgggtccg
cttgaggagatcaacgaagccttcgaccttctggatcagggccgcgtgatcagacacgtg
atagagttctga

DBGET integrated database retrieval system