KEGG   Sinorhizobium medicae: Smed_2891Help
Entry
Smed_2891         CDS       T00555                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
smd  Sinorhizobium medicae
Pathway
smd00220  Arginine biosynthesis
smd00330  Arginine and proline metabolism
smd01100  Metabolic pathways
smd01110  Biosynthesis of secondary metabolites
smd01130  Biosynthesis of antibiotics
smd01230  Biosynthesis of amino acids
Module
smd_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Smed_2891
   00330 Arginine and proline metabolism
    Smed_2891
Enzymes [BR:smd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Smed_2891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 5323768
NCBI-ProteinID: YP_001328556
JGI: Smed2891
UniProt: A6UDJ1
Position
3032444..3033367
Genome map
AA seq 307 aa AA seqDB search
MKTITLIGAPIEEGSGRRGAGMGPTALRIAGIDTVLAELGHTVTDEGDLKPVPARDLAKH
PGANNLQTVAAFARALDEAVHDTARKGNIPIILGGDHALSMGSVSGMARHAHEVGRPLFV
LWLDAHADFNSPVTSPSGNMHGMPVAFFCGEAEFAPILPRDRPLVDPKRVYQVGIRSVDA
REREEIAEHGVNVFDMRTIDEMGMAHIIRQIVDEVRAANGLLHVSLDVDFMDPELAPGVG
TTVPGGATFREAHLIMEVLCDSGLVSSLDVVELNPFLDDRGKSARILVELTASLFGRRIL
DRPTRAA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatcacattgatcggcgcacccatagaggaaggctccggccgccgcggcgca
ggcatggggccgacggcgctcaggatagcaggcatagacaccgtccttgcggaactgggc
catacggtcaccgacgagggggacctgaagccggttccggcgcgagacctcgccaaacat
ccgggcgccaacaatctgcagaccgttgcggctttcgcccgggcgctcgacgaagccgtg
catgacaccgcgcgcaagggaaatatccccatcattctcggcggcgaccacgccctttcg
atgggtagcgtttccggcatggcgcggcatgctcatgaggtcggacggcccctcttcgtc
ctgtggctcgatgcgcatgccgacttcaattcgccggtgacctcgccctcggggaatatg
cacggcatgcccgtcgccttcttttgcggcgaagcggagttcgctccgatccttccgaga
gaccggccgctggtcgatccgaagagggtttaccaggtcgggatccgttcggtggatgcc
cgcgagcgcgaggagatcgcagagcacggcgtcaatgtcttcgatatgcgcaccatcgac
gagatgggcatggctcatattatccgccagatcgtcgacgaggtacgggctgccaacggc
ctcctgcatgtcagcctcgacgtggatttcatggatccggagcttgcccctggcgtcggc
acgacggtccctggcggtgcgacgtttcgcgaggcacatcttatcatggaggtgctatgc
gacagcggcctcgtttcgtcgctcgacgtggtcgagctcaatccgtttctcgacgaccgg
ggaaaaagcgcgcgcatcctggtcgaactgaccgcaagcctcttcggccgccgcatcctg
gaccgcccgacccgcgccgcctga

DBGET integrated database retrieval system