KEGG   Sinorhizobium medicae: Smed_2967Help
Entry
Smed_2967         CDS       T00555                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
smd  Sinorhizobium medicae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:smd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3113520..3114236
Genome map
AA seq 238 aa AA seqDB search
MRVLVTRPRPSAESTAAKLGAMGHETAILPMLQAQHLADAVLTALSVPHQAIAITSAEAV
RVLGSLGPALEPHFGTPLFSVGGATARAAGGLGFTDIRTGPGTGEGLAETVAAHLPAGGA
LVYLAGSPRTGGFERSLHERRVDYRTAECYRMAPVHYSADTLPELVRAGPFDAVLLYSRE
TARRLIATLRESRLQPAELASRCLCLSWPIREILPAGFVSEVAAAPDEENLFRLLEAE
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgctcgtgacccggccacgcccgtcagccgaaagcacggcggcaaagctcggt
gccatgggccatgagacggccatactgccgatgttgcaggcgcagcatctcgccgatgcg
gttctcacggcattgagtgtaccgcatcaggcgattgccatcaccagcgcggaggccgtc
cgcgtcctcggctcgctcgggcctgcgcttgagccacatttcggcacgccgctcttctcg
gtcggaggcgcgaccgcgcgcgcggcgggtggcctcggatttaccgatatccgcacgggg
ccgggaaccggagaggggctcgccgagacggtggctgcccacctccccgctggcggagcc
ctggtctatctcgccggctcgccgcggaccgggggcttcgaacggtccttgcacgaaagg
cgggtcgattacaggaccgccgaatgctatcgaatggcgccggtccactattctgcggac
acgctgcctgaactcgtccgcgctggtccttttgatgcggtgctgctctactcccgcgag
accgcgcggcgcttgatcgcaacattgcgggagagccgccttcagcccgcggaactggct
tcgcgttgcctctgcctgagctggccgatcagagagatcctgccggccggctttgtcagc
gaggttgcagcggcgcccgacgaagaaaatctgttcaggctcctcgaagccgaatag

DBGET integrated database retrieval system