KEGG   Sinorhizobium medicae: Smed_2995Help
Entry
Smed_2995         CDS       T00555                                 

Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
smd  Sinorhizobium medicae
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Smed_2995
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Smed_2995
Enzymes [BR:smd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Smed_2995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3144485..3146857)
Genome map
AA seq 790 aa AA seqDB search
MDAYWRASNYLSVGQIYLLDNPLLRESLKREHIKPRLLGHWGTSPGLNMLYVHLNRVIKR
DDLNMIYVIGPGHGGPSLVAHAYLEGTYSEFYPNISEDTEGMKRLFKQFSFPGGIPSHVA
PETPGSIHEGGELGYALSHAYGAAFDNPDLIVACVVGDGEAETGPLATGWQSNKFLNPAR
DGCVLPILHLNGYKIANPCFLARIPEEELRKFFEGMGYRPYFVEGRDPEDVHQKLAGVLD
TAVGEIKEIWADARTNGNLKRPAWPMIVFRTPKGWTCPPEIDGKKCEDYWRSHQVPMGEM
DKPEHIRILEQWMKSYRPEELFDETGRLTAEIASLAPAGHRRMSDNPHANGGLLLRDLKM
PDFREYAVEVTSPGATMAESARAMGKFLRDVMKANLESKNFRLFSPDENNSNRWQDVLEV
TDRCYMADIYPEDDHLSPDGRIMEVLSEHQCQGWLEGYLLTGRHGFFSCYEAFIHIIDSM
FNQHAKWLKVCGEIPWRRPIGSLNYFLSSHVWRQDHNGFSHQDPGFIDHVVNKKADVIRV
YLPPDANTLLCVTDHCLRSRDYVNVVVAGKQPAPQWLTMSEAVRHCAMGLSIWDWASSDK
GSEPDVVMACCGDVPTLETLAAVQLLREHLPELKVRVVNVVNLMKLQPAEEHPHGLSDRD
FDAFFTRDKPIIFAFHGYPWLIHRFTYRRKNHGNLHVRGYKEEGTTTTPFDMVVLNELDR
FHLVEDVIDRLPQLGARAAYFKQAIHEKLIEHREYIEKHGDDMLAISGWKWGVKDTTAAS
RKTSTEGDNV
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggacgcctactggcgggcttccaactatctctcggtcggccagatatacctgctcgac
aatccgctattgcgggaatccctgaagcgcgagcacatcaagccgcgactgctcggccac
tgggggacgtcgcccggtctcaacatgctctatgtgcatctgaaccgggtcatcaagcgc
gacgatctcaacatgatctacgtcatcggccccggccacggcggaccgtcattggtggcg
cacgcttatctcgaaggcacctacagcgagttctatccgaatatcagcgaggatacggaa
gggatgaagcgactgttcaagcagttcagcttccccggcggcataccgagccatgtcgcg
cccgaaactcccggcagcatccacgagggcggcgaactcggatacgcgctcagccatgcc
tatggcgcggcattcgacaatcccgatctgatcgtcgcctgcgtcgttggcgatggggaa
gctgagaccggtccgctcgcgaccggctggcaaagcaacaaattcctcaatcccgcccgc
gacggctgtgtgctgccgatccttcacctgaacggctataagattgccaacccctgcttc
ctcgcccgcatccccgaggaggaactgcgcaagttcttcgaggggatgggatacaggccc
tatttcgtcgagggccgtgatcccgaggatgttcaccagaagctcgcaggcgtgctcgac
accgcggtcggcgagatcaaggaaatctgggccgatgcccgtacgaacggcaatctcaag
cgcccggcatggccgatgatcgtctttcggacgccaaagggctggacgtgcccgccggag
atcgatggcaagaaatgcgaggactattggcgatcgcatcaggtgcccatgggcgagatg
gacaagccggagcatatccgcattctcgaacaatggatgaaaagctatcggcccgaggag
cttttcgacgagaccggccggctcacggctgaaattgcatcgctcgctccggcgggccac
cgccggatgagcgacaacccccacgccaacggcgggttgcttctgcgtgatttgaagatg
cctgatttcagggaatacgccgtggaggtaaccagccctggcgcgactatggccgagtca
gcccgcgcgatgggcaagttcctgcgcgacgtgatgaaggcaaacctggagagcaagaac
ttccggctgttcagtccggacgagaacaactccaaccgctggcaggatgtgctcgaggtg
accgatcgctgctacatggcggatatctatccggaggacgaccatctctcgccggacggc
cgcatcatggaagtattgagcgagcaccagtgccagggatggctggagggctatctgctg
acaggccgccacggcttcttctcctgctacgaagccttcatccacatcatcgactcgatg
ttcaaccagcatgccaagtggctcaaggtgtgtggcgaaatcccgtggcgcagacccatc
ggctcactgaactatttcctcagttcgcatgtctggcgacaggatcacaacggcttcagc
catcaggaccccggcttcatcgaccatgtcgtcaataaaaaggcggacgtgatccgcgtc
tatctgccgccggacgccaacaccctgctctgcgtcacggaccactgcctgcgcagccgc
gactatgtcaacgtggtcgtcgccggaaaacagcctgcgccgcaatggctgacgatgagc
gaggccgtcaggcactgcgccatgggcctcagcatctgggattgggcgagcagcgacaag
ggcagcgagcccgatgtcgtcatggcctgttgcggcgacgtcccgaccctcgaaacgctt
gcggcggtgcaactgctccgcgaacacctgcccgagctgaaggtgcgggttgtcaatgtc
gtcaacctgatgaagctgcaacctgcggaggagcatccgcacgggctatcggaccgtgat
ttcgacgccttcttcacaagagacaagccgatcatcttcgccttccacggttatccgtgg
ctgatccaccgatttacctatcgcagaaaaaatcacggcaacctgcacgtgcgcggctac
aaggaggaaggcacgacgaccaccccgttcgacatggtggtcctgaacgagctcgaccgg
ttccacctcgtcgaggacgttatcgatcggctgccgcaactcggcgcccgtgccgcctat
ttcaagcaggcaattcacgagaagctgatcgagcatcgcgaatatatcgagaagcatggc
gacgacatgcttgcgatcagcggctggaagtggggcgtgaaagacacgacggcagcgtcc
cggaaaacctctacggaaggggacaacgtctga

DBGET integrated database retrieval system