KEGG   Sinorhizobium medicae: Smed_3010Help
Entry
Smed_3010         CDS       T00555                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
smd  Sinorhizobium medicae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Smed_3010
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Smed_3010
Enzymes [BR:smd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Smed_3010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3158406..3159587
Genome map
AA seq 393 aa AA seqDB search
MTKARKALDKYRRVVIKIGSALLVDRKTGLKKSWLDAMCADIAALRAKGVEVLVVSSGAI
ALGRTVLDLSAGALKLEESQAAAAVGQIVLARAWSESLSTHAIVAGQILLTLGDTEERRR
YLNARATIGQLLRLGSVPIINENDTVATTEIRYGDNDRLAARVATMVGADLLVLLSDIDG
LYTAPPHLDPNARLLETVAEITPDIEAMAGGAASELSRGGMRTKIDAGKIATTAGCAMII
ASGKPEHPLAAVEAGGRSSWFAPAGSPVTARKTWIAGQLLPAGSLSIDAGAETALRSGKS
LLPAGVRQVTGSFGRGDTIAIIGASGREIARGLAGYDAEEARQIAGKKSAEIAVILGYAG
RAAMVHRDDLVMTAPSGGRLAEESDEGKGKLHA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcccgcaaagcgctcgataaataccgccgggtcgtgatcaagataggctcg
gcgctgctcgtcgaccgcaagacgggtttgaagaagagctggctcgacgccatgtgcgcc
gatatcgcggccctcagggccaagggcgtggaggtgctcgtcgtctcctccggggcgatc
gcgctcggacgcacggtgctcgacctttccgcgggtgccttgaagctcgaagagagccag
gcggccgccgccgtcggccagatcgtgctggcgcgtgcctggtcggagagcctctccacc
catgcgatcgtcgccggccagatccttctgacgctcggcgacaccgaggagcgccggcgc
tacctcaatgcccgcgcgacgatcggccagcttctgaggcttggctccgtgccgatcatc
aacgagaatgacacggtcgccacgaccgaaatccgctatggcgacaacgatcggctcgca
gcgcgggtcgcgaccatggtcggcgccgatcttctggtcctgctttcggatatagacggg
ctctatacggcaccgccgcatctcgatccgaatgcccgccttcttgaaaccgtcgccgaa
atcacgcccgacatagaggcaatggcaggcggcgcagcctcggaactctcgcgcggcgga
atgcgcaccaagatcgacgccggcaagatcgccaccacggccggctgcgcgatgatcatc
gcctccggcaagccagagcatccgctggcagcggtggaagcaggtgggcgctcctcctgg
ttcgcccccgccggctctccagtaacggcccgaaaaacctggatcgcagggcagcttctg
ccggccggttcgctctcgatcgacgccggggcggaaacggcgctcagatccggcaagagc
ctgctgccggccggtgtccggcaggtgacgggaagcttcggccgcggcgataccattgcc
ataatcggcgcctcagggcgcgagatcgcccgcgggctcgccggctacgacgccgaggag
gcgcgccagatcgccggcaaaaaatcggctgagatcgccgtcattctcggctatgccggc
cgcgcggccatggtgcaccgcgacgatctggtcatgacggctccatcgggtgggcgcctg
gcggaggaaagcgacgagggaaagggcaagctccatgcttga

DBGET integrated database retrieval system