KEGG   Sinorhizobium medicae: Smed_3031Help
Entry
Smed_3031         CDS       T00555                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
smd  Sinorhizobium medicae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smd00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:smd00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3179518..3180534
Genome map
AA seq 338 aa AA seqDB search
MTTDMEIFGHLASGEPVHRVTLKGGGLTASVITWGSVIQDLRLDGHAPPLVLGFEDFPSY
PAHSSYFGATPGRNANRIGDGRFSLDGRAYQLERNEKGVTHLHGGSDNIARRNWTIVGRD
EDSVTLKITDPDGRAGYPGNCTITCTYRLKPGGTLNVVYETETDAPTLANVCQHSYFNLD
GGSDAFGHDIMIAADHFLPTDERQIPTGEIRPVDGTAFDLREMTSLKRQLDGDRIGYDHN
FCLSPERMQKRSVALVRSINSGVSLEVLTTESGVQLYTGEKLDVAVPGLEGRRYGAFAGF
CLETQIWPDAVNHEGFPNAILRPGETLRQETDYVFTRN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgacatggaaatcttcggccatctggcctcaggcgagcccgtccaccgggtg
accctcaagggcggcggtctgacggcgtcggtaatcacctggggctcggtcatccaggat
ctgcggctcgacggacatgcgccgccgctggtgctcggcttcgaggatttcccaagctat
ccagcccattcctcctatttcggcgccacgcccggccgcaacgccaaccgcatcggcgac
ggccgtttctcgctcgacggcagggcctatcagctcgaacgcaacgagaagggcgtcacg
catctacatgggggcagtgacaatatcgccaggcgcaactggacgatcgtcggacgggac
gaagacagtgtgacgctcaaaatcaccgatccggacggccgtgccggctatcccggcaat
tgcacgatcacctgcacatatcggctgaagcccggcggtacgctcaacgtcgtctacgaa
accgagaccgacgcgccgacgctcgccaatgtctgccagcacagctatttcaacctcgat
ggcggatcggacgcgttcggccacgatatcatgatcgcggcggaccacttcctgcctacc
gacgagcggcagattccaacgggagagatccgccccgtcgacggcaccgccttcgacctg
cgcgaaatgacctcgctcaagcgacaactggacggcgacaggataggctacgatcacaat
ttctgcctctccccggaacggatgcagaagcgatccgtcgcgctggtacgcagcatcaat
tcgggcgtgtcgctggaagttctgacgacggagtccggcgtccagctctataccggagaa
aaactcgacgtagccgttcccggcctcgaaggccgccgctacggcgcctttgcaggcttc
tgtctcgaaacacagatctggcccgatgcggtcaatcacgaaggttttcctaacgcaatt
ctgcggccgggcgaaacgcttcggcaggagacggactacgtcttcaccaggaattga

DBGET integrated database retrieval system