KEGG   Sinorhizobium medicae: Smed_3073Help
Entry
Smed_3073         CDS       T00555                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
smd  Sinorhizobium medicae
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:smd01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3220815..3221456)
Genome map
AA seq 213 aa AA seqDB search
MALKDFLPFLFGLTMTIVLSAAARAEPVSLVGFGDSLMAGYQLPPEDAFPTRLEKALKGK
GIDVTIANAGVSGDTTSGGLARIDWSVPEGTDGVILELGANDALRGIPPEETRKNLEAMI
VRLKKRGIAVLLAGMMAPPNMGPDYGERFNAIYPELAKEHDTVFYPFFLDGVVTEAGLKL
EDGMHPNGEGIAVMVDRFLPTAETFIRTLQEGE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcattaaaagactttctgccctttttattcggcctgacaatgacaatcgtgttatcg
gcggcggctcgtgccgagcccgtaagcctcgtcggcttcggcgacagcctcatggccggc
tatcagcttccccctgaagatgcttttcccacgcgtctcgaaaaggccctgaaaggcaag
ggaatcgatgtcacgatcgccaatgccggcgtttcaggggacacgacctccggcggcctc
gcccgcatagactggtcggtcccggagggaaccgacggagtgatcctggagctcggggcc
aatgatgcgttacgcggcatcccgccggaagagacgcgcaaaaatctcgaagcaatgatc
gtgcggctcaagaagcgcggcatcgcagtcctgcttgctgggatgatggcgccgccgaac
atggggccggattatggggagcgcttcaacgccatctatcccgagctcgccaaggagcat
gacaccgttttctaccccttctttctcgatggcgtcgtcaccgaggccggtctgaagcta
gaagacggaatgcatccgaacggcgagggtatcgccgtaatggtcgatcgcttcctgccg
acggccgagaccttcatccgcacacttcaggaaggagagtga

DBGET integrated database retrieval system