KEGG   Sinorhizobium medicae: Smed_3130Help
Entry
Smed_3130         CDS       T00555                                 

Definition
carbohydrate kinase FGGY
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
smd  Sinorhizobium medicae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Smed_3130
Enzymes [BR:smd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Smed_3130
Exosome [BR:smd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Smed_3130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3279052..3280521
Genome map
AA seq 489 aa AA seqDB search
MTTAILAIDQGTTNSKAVLVSTTGEILSRGASPVGIEHPQPGWVEQNPLRIWESVQEAIA
ACLQKGPRSDILGIAISNQRESVTAWDAATGKPLGPVVSWQCRRSAPACAELSAAGHAER
VRALTGLPIDPMFPGPKMKWLLDRIPPGHEVRLGTIDAWLIHCFTAGAIHACDAGNAARS
QLYDLNRRAWSDELCDLFGVPKSALPEVCDSAARFGVTKNVPGLKDGIPIASAIGDSHAA
LFGHGAFKPGDGKVTFGTGSSIMTTLPRFIAPEQGITTTIAWSIAGRPTYAFEGNILVSA
AALPWMAEMLGLSHVEDLIDLAATAEPRGPGFVPAFVGLGAPYWHADARALFSGITFNTT
RAQMARAVTDSMAFQVHDVFKAMSAQSPTPLGRLYADGGPSKNTFLMQCVADTLNHVITQ
CDAPEASALGAAYLAGLSLGVWPDLAAVASLPRAGKPVLPRPCDAADRLMVWQDAIYRST
VPGPSIMSE
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgccattctcgccatcgaccagggcaccacgaattcaaaagccgttctcgtt
tcgacgaccggtgagatcctctcgcgtggcgcatcgccggtcggcatcgaacatccgcag
cccggctgggtggagcagaacccgcttcgcatctgggaatcggttcaggaggcgattgcc
gcctgcctgcagaagggaccccgatccgacatcctcgggatcgcgatctccaaccagcgc
gagtcggtcaccgcctgggacgccgcaacgggcaagccgctcggcccggtggtcagctgg
caatgccgccgcagcgcgccggcctgcgccgaactcagcgccgcaggccatgccgagcgc
gtccgggcgctcacgggtctccccatagaccctatgttccccggtcccaaaatgaagtgg
ctgctcgatcgcattcccccgggacatgaggtccggctgggcacgatcgacgcgtggctg
atccattgcttcacggctggcgcgatccatgcctgcgatgccggcaatgccgcccgcagc
cagctttacgacctcaaccgccgggcctggagcgacgagctttgcgacctgttcggcgta
cccaaatccgccctgccggaggtgtgcgacagcgccgcccgcttcggcgtcacgaagaat
gtgccggggctgaaggacggaatcccgatcgcctcggcgatcggcgacagccacgccgcg
cttttcggccacggggccttcaaacccggcgacggcaaagtgaccttcggcaccggctct
tctatcatgacgaccctaccccgcttcatcgctcccgagcagggaattacgacgacgatc
gcctggtcgatcgccggccggccgacctatgccttcgagggcaacattctcgtttcggcc
gcggcccttccatggatggccgaaatgctcggcctttcccatgtggaggacctgatcgat
ctcgccgccaccgccgagccccgcggcccgggtttcgtgccggccttcgtgggtctcggc
gccccttactggcacgccgatgcacgagcgctgttttccggcataaccttcaacacgacg
cgcgcccagatggcgcgtgcggtcacggactcaatggccttccaggtccatgacgtcttc
aaggcgatgtcggcacaatcgccgacaccgctcggccgactctatgcggatggcgggccg
agcaagaacactttcctgatgcaatgcgtggccgataccctgaaccatgtcatcactcag
tgcgacgcgccagaggcctcggcgctcggcgcagcctatctggcgggtctctcgctcggc
gtttggcccgatctcgccgctgtcgcttcactgccgcgcgccggcaaacccgtgctgccg
cgcccttgcgatgccgcagatcgcctcatggtttggcaggacgcaatctaccgctcgacc
gttccaggtccttcaattatgagtgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system