KEGG   Sinorhizobium medicae: Smed_3237Help
Entry
Smed_3237         CDS       T00555                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
smd  Sinorhizobium medicae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Smed_3237
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smed_3237
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Smed_3237
Enzymes [BR:smd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Smed_3237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3411810..3413030
Genome map
AA seq 406 aa AA seqDB search
MNQPPKPNSFRSGPDEEGRFGIFGGRFVAETLMPLILDLQDEWARAKNDPAFKAELENLG
RHYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGHGTLKD
AMNEALRDWVTNVDSTYYLIGTAAGPHPYPEMVRDFQAVIGEEAKQQMLEAEGRLPDLVV
AAVGGGSNAIGIFHPFLDDGGVRIVGVEAGGKGLDGDEHCASLTAGSPGVLHGNRTYLLQ
DGDGQIKEGHSISAGLDYPGIGPEHAWLNDIGRVEYVPIMDHEALEAFQILTRLEGIIPA
LEPSHALAEVIKRAPKMGKDEIILMNLSGRGDKDIFTVGKILGMGQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcagccgcctaaaccgaattccttcagatccggacccgatgaagagggccgtttc
ggcatattcggtggccgcttcgtcgccgagacgctgatgccgctgatcctcgacctccag
gacgaatgggcgagggcaaagaatgatccggctttcaaggcggagctggaaaatctcggc
aggcattatatcggccggccgagcccgctctatttcgccgagcgcctgacggccgaactc
ggcggcgcgaagatctacttcaagcgcgaggagctcaatcacacgggctcccataagatc
aataactgcatcggccagatcctgcttgccaagcgcatgggcaagacccgcatcatcgcc
gagaccggcgccggccagcatggtgtggcatcggccaccgtggcggcgcgtttcgggctg
ccttgcgtcgtctatatgggggcgacagacgtggagcggcaggcaccgaacgtcttccgc
atgaagcttctcggcgccgaggtgaagccggtgactgcgggtcacggcaccctcaaggac
gccatgaacgaggcgctgcgggactgggtgaccaatgtcgacagcacctattacctgatc
ggcacggccgccggcccgcatccctatccggagatggtacgcgacttccaggcggtcatc
ggcgaggaagccaagcagcagatgctcgaagccgaaggccggcttccggacctcgtggtt
gcagcggtcggcggtgggtcaaatgcgataggcatcttccatccattcctggatgacggg
ggcgtcaggatcgtcggcgttgaagccggtggcaagggcctggacggcgatgagcattgc
gcctctctcacagccggctcgccgggcgtgctgcatggcaaccgcacttatctgctccag
gacggtgacggccagatcaaggaaggccactcgatttcggccgggctcgattacccgggg
atcggaccggagcatgcctggctgaacgatatcggccgcgtcgaatatgtgccgatcatg
gatcatgaggcgctggaggcgtttcagatcctgacgcggctcgaaggcatcattccggcg
ctcgagccgtcccacgcgcttgccgaagtcatcaagcgtgcgccgaaaatgggcaaggac
gagatcatcctgatgaatctctccggtcgcggcgacaaggacatcttcaccgtcggcaaa
attctcggtatggggcaataa

DBGET integrated database retrieval system