KEGG   Sinorhizobium medicae: Smed_3237Help
Entry
Smed_3237         CDS       T00555                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
smd  Sinorhizobium medicae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Smed_3237
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smed_3237
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Smed_3237
Enzymes [BR:smd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Smed_3237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3411810..3413030
Genome map
AA seq 406 aa AA seqDB search
MNQPPKPNSFRSGPDEEGRFGIFGGRFVAETLMPLILDLQDEWARAKNDPAFKAELENLG
RHYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGHGTLKD
AMNEALRDWVTNVDSTYYLIGTAAGPHPYPEMVRDFQAVIGEEAKQQMLEAEGRLPDLVV
AAVGGGSNAIGIFHPFLDDGGVRIVGVEAGGKGLDGDEHCASLTAGSPGVLHGNRTYLLQ
DGDGQIKEGHSISAGLDYPGIGPEHAWLNDIGRVEYVPIMDHEALEAFQILTRLEGIIPA
LEPSHALAEVIKRAPKMGKDEIILMNLSGRGDKDIFTVGKILGMGQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcagccgcctaaaccgaattccttcagatccggacccgatgaagagggccgtttc
ggcatattcggtggccgcttcgtcgccgagacgctgatgccgctgatcctcgacctccag
gacgaatgggcgagggcaaagaatgatccggctttcaaggcggagctggaaaatctcggc
aggcattatatcggccggccgagcccgctctatttcgccgagcgcctgacggccgaactc
ggcggcgcgaagatctacttcaagcgcgaggagctcaatcacacgggctcccataagatc
aataactgcatcggccagatcctgcttgccaagcgcatgggcaagacccgcatcatcgcc
gagaccggcgccggccagcatggtgtggcatcggccaccgtggcggcgcgtttcgggctg
ccttgcgtcgtctatatgggggcgacagacgtggagcggcaggcaccgaacgtcttccgc
atgaagcttctcggcgccgaggtgaagccggtgactgcgggtcacggcaccctcaaggac
gccatgaacgaggcgctgcgggactgggtgaccaatgtcgacagcacctattacctgatc
ggcacggccgccggcccgcatccctatccggagatggtacgcgacttccaggcggtcatc
ggcgaggaagccaagcagcagatgctcgaagccgaaggccggcttccggacctcgtggtt
gcagcggtcggcggtgggtcaaatgcgataggcatcttccatccattcctggatgacggg
ggcgtcaggatcgtcggcgttgaagccggtggcaagggcctggacggcgatgagcattgc
gcctctctcacagccggctcgccgggcgtgctgcatggcaaccgcacttatctgctccag
gacggtgacggccagatcaaggaaggccactcgatttcggccgggctcgattacccgggg
atcggaccggagcatgcctggctgaacgatatcggccgcgtcgaatatgtgccgatcatg
gatcatgaggcgctggaggcgtttcagatcctgacgcggctcgaaggcatcattccggcg
ctcgagccgtcccacgcgcttgccgaagtcatcaagcgtgcgccgaaaatgggcaaggac
gagatcatcctgatgaatctctccggtcgcggcgacaaggacatcttcaccgtcggcaaa
attctcggtatggggcaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system