KEGG   Sinorhizobium medicae: Smed_3238Help
Entry
Smed_3238         CDS       T00555                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
smd  Sinorhizobium medicae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Smed_3238 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smed_3238 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Smed_3238 (trpA)
Enzymes [BR:smd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Smed_3238 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3413036..3413875
Genome map
AA seq 279 aa AA seqDB search
MTARMEQRFADVAAEGRPVLVTYFMGGDPDFDTSLAIMKALQQAGADIIELGVPFSDPMA
DGPAIQLAGQRALKAGQTLAKTLELARRFRADDQRTPIVLMGYYNPIYIYGVERFLTDAL
EAGVDGMIVVDLPPEMDDELCIPALAKGISFIRLATPTTDDRRLPKVLENTSGFVYYVSM
TGITGSALPDTSLIAGAVARIKAHTSLPVCVGFGVKTADHARAIGATADGVVVGTAIVNQ
IASSLTEEGRATEATVPGVEALVRGLAAGVRAARLAAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcatggagcaaaggttcgccgatgtggcggctgaagggcgcccggttctc
gtgacctatttcatgggcggcgacccggatttcgacacgtcgctcgcgatcatgaaggcg
ctgcagcaggccggcgccgatatcatcgaactcggcgtccccttttccgacccgatggcc
gatggaccggcgatccagctcgccggtcagcgtgcgctcaaggccgggcagacgcttgcc
aagacgctggagcttgcccggcgtttccgggccgacgatcagcgtacccccatcgtgctg
atgggctactacaatcccatctacatctacggcgtcgagcggtttttgacggacgcgctc
gaggccggcgtcgacggcatgatcgtcgtcgacctgccgccggaaatggacgacgaactc
tgcattccggcgctcgcgaagggcatcagcttcatccgcctggctacaccgacgacggat
gaccggcgtctgcccaaagtcctcgaaaatacgtccggtttcgtgtattacgtgtcgatg
accggtatcaccggctcggcgctgccggatacgtcgctgattgccggtgccgtggcgcgc
atcaaggcacatacctccttgccggtctgcgtcggtttcggggtgaagacggcggatcat
gcacgcgccattggtgcaaccgccgatggcgtcgtcgtcggcacggccatcgtcaatcag
atcgcgtcgagtttgacggaagagggccgcgcaacggaagcgacggttccgggtgtcgaa
gcgctcgtcagagggcttgcggccggcgtacgggcggcacgactcgccgcagccgaataa

DBGET integrated database retrieval system