KEGG   Sinorhizobium medicae: Smed_3270Help
Entry
Smed_3270         CDS       T00555                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
smd  Sinorhizobium medicae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smed_3270
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Smed_3270
   00630 Glyoxylate and dicarboxylate metabolism
    Smed_3270
Enzymes [BR:smd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Smed_3270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3450562..3452736
Genome map
AA seq 724 aa AA seqDB search
MNRVEQDGLKIDAGLHRFLVEEAMPGTGVDPERFFSAFSDLIHDLGPKNRALLVKRDELQ
AKLDGWYRDHGAPVDMDAYEAFLKEIGYLLPEGSDFSVSTANVDPEIATIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIPDAEGAERGKGYNPKRGGRVIAWARDFLDASAPL
SSGRWIDATSLAIEGAALTVTLANGAKTALAMPAQFAGYSGNAAAPSEIVLRKNGLHVAI
VLDPTTPIGKADAAGIADIILESAITTIMDCEDSVAAVDAEDKVLVYRNWLGLMKGDLEE
QVAKGTTTFIRRLNPDRIYTASGGDKLTLPGRSLMLVRNVGHLMTNPAILDREGKEVPEG
LMDAMVTALIALHDIGRNGRRANSRSGSMYVVKPKMHGPEEVAFACETFTRVEAALGLPA
NAMKMGIMDEERRTTVNLKECIRAARERVVFINTGFLDRTGDEIHTSMEAGAMIRKGDMK
QAAWISAYENWNVDVGLECGLSGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHRINVSEIQNGLRSRSRAKLADILSVPVAARPNWTEEEIQRELDNNAQG
ILGYVVRWVDHGIGCSKVPDINNVGLMEDRATLRISAQHMANWLHHGIVSEAQIVETMKR
MAAVVDAQNAGDPNYQPMASRFDESIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKTK
QRAA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcgttgagcaggacggattgaagatcgatgcggggcttcaccgcttcctggtg
gaagaggcgatgccgggcaccggcgtcgatccggagcggttcttttccgccttctcggat
ctcatccacgatctcggaccgaaaaaccgcgcccttctcgtcaagcgcgacgagctgcag
gccaagctcgacggctggtatcgcgatcacggcgcgcccgtcgacatggacgcctatgaa
gccttcctgaaggaaatcggctatctcctgccggaggggtccgacttctccgtctcgaca
gccaatgtcgatccggagatcgccacgatcgccggaccgcagcttgtcgtgcctgtcatg
aacgcgcgctatgcgctcaatgcggccaatgcgcgctggggatcgctctatgacgcgctt
tacgggaccgacgcgattccggatgcggaaggcgccgagcgcggcaagggctacaatccg
aaacgcgggggaagggtcatcgcctgggcacgtgatttcctcgacgccagcgctccgctt
tcgtccggccgttggatcgatgcgacgtctctggcaatcgaaggcgcggcactgaccgtc
acgcttgcgaacggcgcgaagaccgcacttgccatgcccgcgcaattcgccggctattcc
ggaaacgctgcagccccgtccgagatcgtccttcgcaaaaacgggcttcacgtcgcgatc
gtcctcgatccgacgactccgatcggcaaggccgatgctgccggcattgccgatatcatt
ctcgaatcggcgatcaccactatcatggattgcgaggattcggtcgcggccgtcgatgcc
gaggacaaggtgctcgtctatcgcaactggctcgggctcatgaagggcgacctcgaggaa
caggtggccaagggcaccaccactttcatccggaggctcaatcccgatcgtatctatact
gcatcgggaggcgataagctgactcttccgggccgttcgctgatgctggtgcgcaatgtc
ggccacctgatgaccaatccggctatcctcgaccgtgagggcaaggaagtgccggagggc
ctgatggacgccatggtgacggcgctgatcgccttgcacgacatcggccggaacggccgc
cgggcgaattcgcgcagcggctcaatgtatgtcgtcaagccgaagatgcacgggcccgag
gaagtcgccttcgcctgcgagacattcacccgtgtcgaggcagcgctcgggcttccggcc
aacgcgatgaagatgggaataatggacgaggagcggcggacgaccgtcaatctcaaggaa
tgcatccgcgcggcccgcgagcgcgtcgttttcatcaataccggcttcctcgaccgcacc
ggcgacgaaatccacacctccatggaagccggcgcgatgatccgcaagggcgacatgaag
caggcggcctggatctcggcctatgagaactggaatgtcgatgtcggtctcgaatgcggg
ctttccggtcatgcccagatcggcaagggtatgtgggcgatgccggacctgatggcggcg
atgctggagcagaagatcgctcatccgaaggccggtgcaaataccgcctgggtcccatcg
ccgacggccgcgacgctgcacgcaacccattaccaccgcatcaacgtctccgagatccag
aatggtctcagaagccgctcccgagcgaagctcgccgacattctttccgttccggtggct
gcgcggccgaactggaccgaggaggaaatccagcgcgaactcgacaacaatgcgcaaggg
attcttggctatgtcgtgcgctgggtcgaccatggcatcggctgctccaaggtaccggac
atcaacaatgtcggcctgatggaggaccgtgcaactctgcgtatctctgcacagcatatg
gccaactggctgcatcacggcatcgtcagcgaagcgcagatcgtcgagacgatgaagcgc
atggccgcggttgtcgacgcgcagaacgccggcgacccgaattaccagcctatggccagc
cgcttcgacgaatcgatcgcctttcaggcggcgctcgatctggtgctcaagggtcgcgaa
cagccgaacggctacaccgaaccggttttgcatcgccggcggctggagctcaagacgaag
cagcgggcggcgtag

DBGET integrated database retrieval system