KEGG   Sinorhizobium medicae: Smed_3270Help
Entry
Smed_3270         CDS       T00555                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
smd  Sinorhizobium medicae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smed_3270
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Smed_3270
   00630 Glyoxylate and dicarboxylate metabolism
    Smed_3270
Enzymes [BR:smd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Smed_3270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3450562..3452736
Genome map
AA seq 724 aa AA seqDB search
MNRVEQDGLKIDAGLHRFLVEEAMPGTGVDPERFFSAFSDLIHDLGPKNRALLVKRDELQ
AKLDGWYRDHGAPVDMDAYEAFLKEIGYLLPEGSDFSVSTANVDPEIATIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIPDAEGAERGKGYNPKRGGRVIAWARDFLDASAPL
SSGRWIDATSLAIEGAALTVTLANGAKTALAMPAQFAGYSGNAAAPSEIVLRKNGLHVAI
VLDPTTPIGKADAAGIADIILESAITTIMDCEDSVAAVDAEDKVLVYRNWLGLMKGDLEE
QVAKGTTTFIRRLNPDRIYTASGGDKLTLPGRSLMLVRNVGHLMTNPAILDREGKEVPEG
LMDAMVTALIALHDIGRNGRRANSRSGSMYVVKPKMHGPEEVAFACETFTRVEAALGLPA
NAMKMGIMDEERRTTVNLKECIRAARERVVFINTGFLDRTGDEIHTSMEAGAMIRKGDMK
QAAWISAYENWNVDVGLECGLSGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHRINVSEIQNGLRSRSRAKLADILSVPVAARPNWTEEEIQRELDNNAQG
ILGYVVRWVDHGIGCSKVPDINNVGLMEDRATLRISAQHMANWLHHGIVSEAQIVETMKR
MAAVVDAQNAGDPNYQPMASRFDESIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKTK
QRAA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcgttgagcaggacggattgaagatcgatgcggggcttcaccgcttcctggtg
gaagaggcgatgccgggcaccggcgtcgatccggagcggttcttttccgccttctcggat
ctcatccacgatctcggaccgaaaaaccgcgcccttctcgtcaagcgcgacgagctgcag
gccaagctcgacggctggtatcgcgatcacggcgcgcccgtcgacatggacgcctatgaa
gccttcctgaaggaaatcggctatctcctgccggaggggtccgacttctccgtctcgaca
gccaatgtcgatccggagatcgccacgatcgccggaccgcagcttgtcgtgcctgtcatg
aacgcgcgctatgcgctcaatgcggccaatgcgcgctggggatcgctctatgacgcgctt
tacgggaccgacgcgattccggatgcggaaggcgccgagcgcggcaagggctacaatccg
aaacgcgggggaagggtcatcgcctgggcacgtgatttcctcgacgccagcgctccgctt
tcgtccggccgttggatcgatgcgacgtctctggcaatcgaaggcgcggcactgaccgtc
acgcttgcgaacggcgcgaagaccgcacttgccatgcccgcgcaattcgccggctattcc
ggaaacgctgcagccccgtccgagatcgtccttcgcaaaaacgggcttcacgtcgcgatc
gtcctcgatccgacgactccgatcggcaaggccgatgctgccggcattgccgatatcatt
ctcgaatcggcgatcaccactatcatggattgcgaggattcggtcgcggccgtcgatgcc
gaggacaaggtgctcgtctatcgcaactggctcgggctcatgaagggcgacctcgaggaa
caggtggccaagggcaccaccactttcatccggaggctcaatcccgatcgtatctatact
gcatcgggaggcgataagctgactcttccgggccgttcgctgatgctggtgcgcaatgtc
ggccacctgatgaccaatccggctatcctcgaccgtgagggcaaggaagtgccggagggc
ctgatggacgccatggtgacggcgctgatcgccttgcacgacatcggccggaacggccgc
cgggcgaattcgcgcagcggctcaatgtatgtcgtcaagccgaagatgcacgggcccgag
gaagtcgccttcgcctgcgagacattcacccgtgtcgaggcagcgctcgggcttccggcc
aacgcgatgaagatgggaataatggacgaggagcggcggacgaccgtcaatctcaaggaa
tgcatccgcgcggcccgcgagcgcgtcgttttcatcaataccggcttcctcgaccgcacc
ggcgacgaaatccacacctccatggaagccggcgcgatgatccgcaagggcgacatgaag
caggcggcctggatctcggcctatgagaactggaatgtcgatgtcggtctcgaatgcggg
ctttccggtcatgcccagatcggcaagggtatgtgggcgatgccggacctgatggcggcg
atgctggagcagaagatcgctcatccgaaggccggtgcaaataccgcctgggtcccatcg
ccgacggccgcgacgctgcacgcaacccattaccaccgcatcaacgtctccgagatccag
aatggtctcagaagccgctcccgagcgaagctcgccgacattctttccgttccggtggct
gcgcggccgaactggaccgaggaggaaatccagcgcgaactcgacaacaatgcgcaaggg
attcttggctatgtcgtgcgctgggtcgaccatggcatcggctgctccaaggtaccggac
atcaacaatgtcggcctgatggaggaccgtgcaactctgcgtatctctgcacagcatatg
gccaactggctgcatcacggcatcgtcagcgaagcgcagatcgtcgagacgatgaagcgc
atggccgcggttgtcgacgcgcagaacgccggcgacccgaattaccagcctatggccagc
cgcttcgacgaatcgatcgcctttcaggcggcgctcgatctggtgctcaagggtcgcgaa
cagccgaacggctacaccgaaccggttttgcatcgccggcggctggagctcaagacgaag
cagcgggcggcgtag

DBGET integrated database retrieval system