KEGG   Sinorhizobium medicae: Smed_3369Help
Entry
Smed_3369         CDS       T00555                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
smd  Sinorhizobium medicae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smed_3369 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smed_3369 (glk)
   00052 Galactose metabolism
    Smed_3369 (glk)
   00500 Starch and sucrose metabolism
    Smed_3369 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Smed_3369 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Smed_3369 (glk)
   00524 Butirosin and neomycin biosynthesis
    Smed_3369 (glk)
Enzymes [BR:smd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Smed_3369 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3570692..3571711
Genome map
AA seq 339 aa AA seqDB search
MPNASDQSFPFPILIGDIGGTNARFALLTDAYGEPRQLEPIRTGDFATIEEAMQKSILDK
TSVQPRSAILAVAGPIKGDEIPLTNAHWVIRPKDMLASLGLEDVLIINDFEAQALAIAAP
ADQDVVQIGGGAVRPFNSRVVLGPGTGLGVAGLVYAQHSWIPVPGEGGHVDLGPRTERDF
EIWPFLEPIEGRMAGEQILCGRGIMNLYRAVCAANGEAAVLADQAAVTTSALSGADAAAV
ETVSLFATYLGRVAGDMALIFMARGGVFLAGGISQKILPALMKPEFRAAFEDKAPHSALM
RTIPTFAVIHPMAALSGLAAFARTPRDFGVAMEGRRWRR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcccaatgcgagtgaccaaagcttcccctttccgattttgatcggcgacatcggcggc
accaatgcccgcttcgcattgcttaccgacgcctatggcgagccgaggcagcttgagccg
atcaggacgggcgatttcgccaccatcgaagaggcaatgcagaaaagcatcctcgacaag
acttccgtccagccgcgctcggcgattcttgccgtagcggggccgatcaagggcgacgag
ataccgctgacgaatgcccattgggtgattcgcccgaaggatatgctggcgagcctcggc
ctcgaagacgtgctgatcatcaatgatttcgaggcgcaggcgctcgccattgccgccccg
gccgaccaggacgtcgtgcagatcggcggcggcgcggtccggcccttcaattcgcgcgtc
gtccttggtccgggtaccggtctgggggtcgcgggcctcgtctatgcgcagcacagctgg
atacccgtccccggagaaggcgggcatgtcgatttaggtccgcgcaccgagcgcgacttt
gagatatggccgtttctggagccgatcgaggggcgcatggccggcgagcagatactgtgc
ggccgcggcatcatgaatctctatcgcgcggtctgcgccgccaatggcgaagcggcggtt
ctcgcggatcaggcggcggtgacgacgagtgcgttgtccggtgcggatgccgcggcggtc
gaaaccgtgtcgctctttgcgacttatctcgggcgcgttgccggcgatatggcgcttatc
ttcatggcgcggggcggggtattccttgccggcggcatttcgcagaagatcctgccggcg
ctgatgaagcctgagttccgcgccgccttcgaggacaaggcgccacattcggcgctgatg
cggacgatcccgacctttgccgtcatccacccgatggccgcgctctccggcctcgcagcc
tttgcccgcacgccgagggacttcggtgttgcaatggagggacgccgctggagaaggtga

DBGET integrated database retrieval system