KEGG   Sinorhizobium medicae: Smed_3435Help
Entry
Smed_3435         CDS       T00555                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
smd  Sinorhizobium medicae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:smd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Smed_3435 (recR)
DNA repair and recombination proteins [BR:smd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Smed_3435 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3639751..3640356
Genome map
AA seq 201 aa AA seqDB search
MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLVKKKEQLLGPLAEAMGEAHRKVKIC
SCCGNVDTIDPCTVCGDERRDQAVIIVVEDVADLWALERAGAMNAAYHVLGGTLSPLDGI
GPEDLNIRALVDRVAKGGVRELIIAVNATVEGQTTAHYITDQLEGMEVRITRLAHGVPVG
GELDYLDEGTLAAALRARTAI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcgagtcaccggtcccgaaattgaaaagctcatccagctcctggcgaaggtt
ccgggtctcggaccccgttccgctcgccgcgcggcgttgcatctcgtcaagaagaaggag
cagctgctcgggccgcttgccgaggccatgggcgaggcccatcgcaaggtcaagatctgc
tcctgctgcggcaatgtcgacaccatcgatccctgcacggtctgcggcgacgagcggcgc
gatcaggcggtgatcatcgtcgtcgaagacgtcgccgatctctgggcgctggagcgcgcc
ggcgcgatgaacgccgcctatcacgtgctcggcggcacgctctcgccgctcgacggcatc
gggccggaagatctgaacataagggcattggtcgatcgtgtcgccaagggcggcgtgcgc
gagctgatcatcgccgtcaacgccacggtcgagggccagacgacagcgcattacatcacc
gatcagctcgaagggatggaggtgaggatcacccgcctcgctcatggtgtccccgtcggc
ggcgagctggactatcttgacgagggaacgctcgctgccgcgctgagagcgagaacggcg
atctga

DBGET integrated database retrieval system