KEGG   Sinorhizobium medicae: Smed_3633Help
Entry
Smed_3633         CDS       T00555                                 

Definition
(RefSeq) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
smd  Sinorhizobium medicae
Pathway
smd00051  Fructose and mannose metabolism
smd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Smed_3633
Enzymes [BR:smd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Smed_3633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-GeneID: 5318319
NCBI-ProteinID: YP_001312379
JGI_p1: Smed3633
UniProt: A6UFL6
Position
pSMED01:complement(67110..67826)
Genome map
AA seq 238 aa AA seqDB search
MAETDKLALRREMVDICRRMNSSGINQGTAGNLSLRTDDGFLITPSSMPYETMQPEDLVE
MAFDGTYVGHRPSSEWRFHRDILRARTDIDVVLHCHSIYATTLACHHKTIPSFHYMTGIA
GGTTIRCAEYATFGTQALSDNALVALKGRLACLLGQHGQISLGKTLEQALWLAIEVETLS
RIYVQALTLGEPPVLPDDEMERVIAQMRRMSYGQAPDAEGVNDVARPRDALGNSGKSV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaacggacaagctggcacttcggcgagagatggtggacatctgccggcggatg
aattcgagtggcatcaaccagggtacggccggcaatctctcgctccggaccgatgacggc
ttcctcatcacgccctcatccatgccctatgagacgatgcaaccggaagacctggtggag
atggccttcgacggcacctatgtgggccatcggccgtcatcggaatggcgcttccatcgc
gacattctgcgcgcgcgcaccgatatagacgtggtcctgcattgccattcgatctatgcg
acgacgcttgcgtgccaccacaagaccatcccgagctttcactacatgacgggaattgcc
ggcggcacgacgatacgctgcgccgaatacgccaccttcggcacccaggcgctctccgac
aacgcgcttgtcgcgctcaagggccgcctggcttgcctgctcggtcaacacggacagatc
tctctcggcaagacgctggaacaggccctgtggcttgcgatcgaagtcgagacactgtcg
cggatctatgtccaggccctcacccttggcgagccgcccgtgctgcccgacgacgagatg
gagcgcgtaatcgcccagatgcgacgcatgagctatggccaggcgcccgacgccgaaggc
gtgaacgacgtagcacgcccgcgcgatgccttgggcaattccggcaagagtgtgtag

DBGET integrated database retrieval system