KEGG   Sinorhizobium medicae: Smed_3715Help
Entry
Smed_3715         CDS       T00555                                 

Definition
acetone carboxylase subunit gamma
Orthology
K10856  
acetone carboxylase, gamma subunit [EC:6.4.1.6]
Organism
smd  Sinorhizobium medicae
Brite
Enzymes [BR:smd01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.6  acetone carboxylase
     Smed_3715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI_p1: 
UniProt: 
Position
pSMED01:complement(156898..157395)
Genome map
AA seq 165 aa AA seqDB search
MTTYSKEIINDLVNGTLPWPQTRRIMSAYKDDDRFFKYLAVLQDRVAWAEAVLLPVGDRL
FICDSAEGRITRCECGYSFGDYRKNWKLKAAINVRDTEESLREIYPNSDIPDSQWMEIRE
FFCPECAHLHEVEAAAPGYPIVHDFEPDLEGFYRDWLGKPLKDQS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaccacatattcgaaggaaatcatcaacgacctcgtcaacggaacgctcccctggccg
cagacgcggcggatcatgagcgcctacaaggacgacgaccgattcttcaagtatctggca
gtgctgcaggaccgcgtggcctgggccgaggccgtcctgctgccggtcggcgatcgcctc
ttcatctgcgacagcgccgagggtcggatcacccgctgcgagtgcggctattccttcggc
gactatcgcaaaaactggaaactgaaagcggcgatcaacgttcgcgacaccgaggagagc
ttgcgggaaatctaccccaacagcgatatcccggattctcagtggatggagatccgagag
ttcttctgccccgaatgcgcgcatctgcacgaagtcgaagcggcagcccccggctacccg
atcgtccatgatttcgagccggacctcgaagggttctatcgcgactggctcggcaagcca
ttgaaggatcagtcatga

DBGET integrated database retrieval system