KEGG   Sinorhizobium medicae: Smed_3944Help
Entry
Smed_3944         CDS       T00555                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
smd  Sinorhizobium medicae
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Smed_3944
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Smed_3944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI_p1: 
UniProt: 
Position
pSMED01:complement(394439..394849)
Genome map
AA seq 136 aa AA seqDB search
MASRLGSVLTAAVLIGGILGAAAPALALDPAAGDPAAGAKVFRKCQACHTVGPDAKSKTG
PLLNGIIGRSAGKVEGYAYSPAIEKAAEAGLTWTPEKIAEFLTSPKGFLPGTKMTFAGLR
KDQERADIIAYLATFP
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaagacttggttccgtactgaccgctgccgtcctgattggcggaattctcggc
gcagccgcgccggcacttgcactggatcccgcagccggagatccagcggcgggcgcgaaa
gtcttccgcaagtgtcaggcctgtcatacggtcggcccggatgccaaatcgaaaaccggc
cccttgctgaacgggatcatcggccggtctgcgggcaaggtcgagggctacgcctattcc
ccggcgatcgagaaagcggctgaggccgggcttacctggacgccggaaaagatcgccgag
tttctgaccagtccgaagggcttcctgcccggcaccaagatgacctttgcgggactgcgc
aaggatcaggaacgtgccgacatcatcgcatatctggcaactttcccctga

DBGET integrated database retrieval system