KEGG   Sinorhizobium medicae: Smed_4013Help
Entry
Smed_4013         CDS       T00555                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
smd  Sinorhizobium medicae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Smed_4013
Enzymes [BR:smd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Smed_4013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI_p1: 
UniProt: 
Position
pSMED01:complement(469325..470272)
Genome map
AA seq 315 aa AA seqDB search
MSVIVLLGDINVDLALEISTYPPEGGEAIATAQRMFLGGSATNTAVALSRSGHRCRLIGR
VGDDGWGKQALRDLRGEGIDTTWIGRDSAEPTQINVVTVGSTGERTMFAYRGANAQLSPA
AIDAAAFDAAELFHLSGYAFLQSPQSEAADHAIGLAVARNIPITLDIPGGIVSRLASRVR
TILPRLDTIVLGDADLAPLADKPYGTSLEEAVRALLDLGVERVAVKANEGRSLLCSAGVT
ESASWLPADAFDTTGAGDAFAAGHIHGRLTGMTGRECCRLANAFGALAVARRGAGLAMPA
IDEALALLGASDGPS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcatcgtcctgcttggtgacatcaacgtcgatctggcccttgagatctccact
tatccgcccgaaggcggagaggcgatcgcgaccgcccagaggatgtttctgggcggttct
gcgacgaatacggcggttgccctttcgaggtcggggcaccgatgcaggcttatcggcagg
gtcggtgatgacggctggggcaaacaggcccttcgggatctgcgaggcgagggtatagac
accacttggatcggtcgggattcggcagaaccgacccagatcaatgtcgtgaccgtcggc
agcaccggcgagcgaaccatgttcgcctatcgcggcgccaatgcacagctttcgccggcc
gcaatcgacgcggcggcgttcgatgcagccgaactcttccacctgtccggctacgccttc
ctgcagagcccccaatcggaggctgccgatcatgcaatcggcctggccgtcgcccgcaac
attccgatcaccctcgatattccgggcggcatcgtttcgaggcttgcatcgcgcgtacgg
accatcctgccgaggcttgacacgatcgtgctcggcgatgcggacctagctccgctggcc
gacaagccgtacggcacaagcctggaagaggcagttcgcgccctgctcgatctcggcgtc
gaacgcgttgcggtaaaggcgaatgagggtcggtcgttgctctgtagcgcaggggtgacg
gagagcgcctcctggctccccgccgatgctttcgataccacgggagccggcgacgccttc
gccgccgggcacatccatggccgcctcaccggaatgacgggacgggaatgctgccgtctt
gctaatgccttcggcgcgctggcggtcgcccggcgaggagccggtctcgccatgccggcg
atcgatgaggccctcgccttgctgggggcctcggacgggccatcatga

DBGET integrated database retrieval system