KEGG   Sinorhizobium medicae: Smed_4111Help
Entry
Smed_4111         CDS       T00555                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
smd  Sinorhizobium medicae
Pathway
smd00020  Citrate cycle (TCA cycle)
smd00310  Lysine degradation
smd01100  Metabolic pathways
smd01110  Biosynthesis of secondary metabolites
smd01120  Microbial metabolism in diverse environments
smd01130  Biosynthesis of antibiotics
smd01200  Carbon metabolism
Module
smd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Smed_4111
  Amino acid metabolism
   00310 Lysine degradation
    Smed_4111
Enzymes [BR:smd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Smed_4111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-GeneID: 5318546
NCBI-ProteinID: YP_001312851
JGI_p1: Smed4111
UniProt: A6UGY8
Position
pSMED01:576499..577659
Genome map
AA seq 386 aa AA seqDB search
MVDLIDIQAPLEQEGTKAVVRNWLREIGEKVKSGDPLVELETDKVTQEVAAPADGVLLEI
LMRNGDDARPGAVLGRIGSELAGGEDAPHYSPAVRRAAEEYGFDPATITGTGRDGRVTRG
DMDRAFAARQAGGASPEPRPDGGRGEPESSRIPHSSMRAAIAEHMLNSVMTAPHVTAVFE
ADFSAVTRHRDEHRKKLAARGVNLSYTAYVVLASLAAMRAVPEVNSRWHEDALETFDDIN
IGVGISLGGKGLVVPVIRRAQNLSLAEIAARIQDLTTRARSNALSPADVTGGTFTISNHG
VSGSLLATPIIINQPQSAILGVGKLDKRVVVREVDGIDTIQIRPMAYVSLTIDHRALDGH
HTNAWLTEFVRVLESWPGEATKNGLA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacctcatcgacattcaggctcctttggagcaggaggggacgaaagcggttgtt
cgcaactggctcagggaaatcggcgaaaaggtcaaatcgggcgacccgctggtcgagctt
gaaacggataaggtgacccaggaggtggcggctcctgccgacggggtgcttctcgagatc
ctgatgcggaacggcgacgatgccaggcccggcgccgttctcggccggatcggcagcgag
cttgccggaggcgaagatgcgccgcattattcccccgccgtgcgacgggcagcggaagaa
tatggcttcgatcctgcgaccatcaccggcaccggccgggatggccgtgttacgcgcggc
gacatggacagggcgttcgcggcgcggcaggcgggcggagcatcgcccgagccccggccc
gacggcgggagaggggagcccgaatccagccggataccgcatagcagcatgcgcgccgca
atcgccgaacatatgctcaactccgtaatgacggcgccgcatgtgacggccgtattcgag
gcagatttctcggcggtgacgcgtcatcgggacgaacacaggaagaagcttgcggcacgg
ggcgtcaatctttcctacactgcctatgttgttctggcctcgctggcggcgatgcgcgcg
gttcccgaggtgaacagccgctggcacgaggatgcgctcgaaacattcgatgacatcaat
atcggcgttgggatttcccttggtggaaagggactggtcgtccctgtaatccgccgcgcg
cagaatctgtcgctggcggagattgcggcccgaattcaggacctgacgacgcgcgcgcgt
tccaacgcgctctcccccgcagacgtgacgggcggcacgttcaccatttccaatcacgga
gtctccggatccctgctcgcgacgccgatcatcatcaaccagccgcaatcggcaatcctc
ggtgtcgggaaactcgacaagcgggtggtcgttcgcgaggtggacggcatcgatacgatt
cagatccggccgatggcctatgtgtcgctgacgattgaccatcgggcactggacggccac
cacacgaatgcgtggctaacggaattcgtccgtgtcctcgagagctggccgggtgaagca
acgaagaacggcttggcctga

DBGET integrated database retrieval system